Overview

  • Product name

  • Description

    Rabbit polyclonal to IFI27
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human IFI27 aa 1-119.
    Sequence:

    MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAVPMVLSA MGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLT KFILGSIGSAIAAVIARFY


    Database link: NP_005523.3

  • Positive control

    • IFI27-transfected 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab171919 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 11 kDa.

Target

  • Function

    Promotes cell death. Mediates IFN-induced apoptosis characterized by a rapid and robust release of cytochrome C from the mitochondria and activation of BAX and caspases 2, 3, 6, 8 and 9.
  • Sequence similarities

    Belongs to the IFI6/IFI27 family.
  • Cellular localization

    Mitochondrion. Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2310061N23Rik antibody
    • FAM 14D antibody
    • FAM14D antibody
    • IFI 27 antibody
    • IFI27 antibody
    • IFI27_HUMAN antibody
    • Interferon alpha induced 11.5 kDa protein antibody
    • Interferon alpha inducible protein 27 antibody
    • Interferon alpha-induced 11.5 kDa protein antibody
    • Interferon alpha-inducible protein 27 antibody
    • interferon alpha-inducible protein 27, mitochondrial antibody
    • Interferon inducible protein 27 antibody
    • interferon-stimulated gene 12 antibody
    • Interferon-stimulated gene 12a protein antibody
    • ISG 12 antibody
    • ISG12 antibody
    • ISG12(a) antibody
    • ISG12(a) protein antibody
    • ISG12A antibody
    • mitochondrial antibody
    • p27 antibody
    see all

Images

  • All lanes : Anti-IFI27 antibody (ab171919) at 1 µg/ml

    Lane 1 : IFI27-transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Rabbit IgG (H+L) at 1/7500 dilution

    Developed using the ECL technique.

    Predicted band size: 11 kDa

References

This product has been referenced in:

  • Liu Z  et al. miR-370 regulates ISG15 expression and influences IFN-a sensitivity in hepatocellular carcinoma cells. Cancer Biomark 22:453-466 (2018). Read more (PubMed: 29758929) »
  • Liu N  et al. miR-942 decreases TRAIL-induced apoptosis through ISG12a downregulation and is regulated by AKT. Oncotarget 5:4959-71 (2014). Read more (PubMed: 24970806) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171919.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up