Overview

  • Product name

  • Description

    Rabbit polyclonal to IFI35
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human IFI35 aa 2-286. Two N-terminal tags. Expressed in E.coli.
    Sequence:

    SAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPLV FRGHTQQDPEVPKSLVSNLRIHCPLLAGSALITFDDPKVAEQVLQQKEHT INMEECRLRVQVQPLELPMVTTIQMSSQLSGRRVLVTGFPASLRLSEEEL LDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQFTVP LGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDVL EIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESG


    Database link: P80217

  • Positive control

    • WB: Recombinant human IFI35 protein; Human lung lysate; HeLa whole cell lysate (ab150035); Pig liver lysate. IHC-P: Human liver tissue. ICC/IF: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233415 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 5 - 20 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml.

Target

  • Function

    Not yet known.
  • Tissue specificity

    In a wide range of cell types, including fibroblasts, macrophages, and epithelial cells.
  • Sequence similarities

    Belongs to the NMI family.
  • Cellular localization

    Nucleus. Nuclear following IFN treatment.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ21753 antibody
    • IFI 35 antibody
    • Ifi-35 antibody
    • Ifi35 antibody
    • IFP 35 antibody
    • IFP35 antibody
    • IN35 antibody
    • IN35_HUMAN antibody
    • Interferon induced 35 kDa protein antibody
    • Interferon-induced 35 kDa protein antibody
    • OTTHUMP00000236626 antibody
    • OTTHUMP00000236627 antibody
    see all

Images

  • Anti-IFI35 antibody (ab233415) at 2 µg/ml + Recombinant human IFI35 protein

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution
  • All lanes : Anti-IFI35 antibody (ab233415) at 2 µg/ml

    Lane 1 : Human lung lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 3 : Pig liver lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution
  • Formalin-fixed, paraffin-embedded human liver tissue stained for IFI35 using ab233415 at 10 μg/ml in immunohistochemical analysis. DAB staining.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for IFI35 (green) using ab233415 at 20 μg/ml in ICC/IF. FITC staining.

References

ab233415 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233415.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up