Anti-IFI44 antibody (ab172499)
Key features and details
- Rabbit polyclonal to IFI44
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-IFI44 antibody
See all IFI44 primary antibodies -
Description
Rabbit polyclonal to IFI44 -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Chimpanzee -
Immunogen
Full length protein corresponding to Human IFI44 aa 1-444.
Sequence:MAVTTRLTRLHEKILQNHFGGKRLSLLYKGSVHGFRNGVLLDRCCNQGPT LTVIYSEDHIIGAYAEESYQEGKYASIILFALQDTKISEWKLGLCTPETL FCCDVTKYNSPTNFQIDGRNRKVIMDLKTMENLGLAQNCTISIQDYEVFR CEDSLDERKIKGVIELRKSLLSALRTYEPYGSLVQQIRILLLGPIGAGKS SFFNSVRSVFQGHVTHQALVGTNTTGISEKYRTYSIRDGKDGKYLPFILC DSLGLSEKEGGLCRDDIFYILNGNIRDRYQFNPMESIKLNHHDYIDSPSL KDRIHCVAFVFDASSIQYFSSQMIVKIKRIRRELVNAGVVHVALLTHVDS MDLITKGDLIEIERCEPVRSKLEEVQRKLGFALSDISVVSNYSSEWELDP VKDVLILSALRRMLWAADDFLEDLPFEQIGNLREEIINCAQGKK
Database link: NP_006408.2 -
Positive control
- IFI44-transfected 293T cell lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Constituent: 100% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab172499 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 1 µg/ml. Predicted molecular weight: 50 kDa. |
Target
-
Function
This protein aggregates to form microtubular structures. -
Sequence similarities
Belongs to the IFI44 family. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 456971 Chimpanzee
- Entrez Gene: 10561 Human
- Omim: 610468 Human
- SwissProt: P27473 Chimpanzee
- SwissProt: Q8TCB0 Human
- Unigene: 82316 Human
-
Alternative names
- hepatitis C-associated microtubular aggregate protein (44kD) antibody
- IFI 44 antibody
- Ifi44 antibody
see all
Images
-
All lanes : Anti-IFI44 antibody (ab172499) at 1 µg/ml
Lane 1 : IFI44-transfected 293T cell lysate
Lane 2 : Non-transfected 293T cell lysate
Lysates/proteins at 15 µl per lane.
Secondary
All lanes : Goat Anti-Rabbit IgG (H+L) at 1/7500 dilution
Developed using the ECL technique.
Predicted band size: 50 kDa
Datasheets and documents
References (1)
ab172499 has been referenced in 1 publication.
- DeDiego ML et al. Interferon-Induced Protein 44 Interacts with Cellular FK506-Binding Protein 5, Negatively Regulates Host Antiviral Responses, and Supports Virus Replication. mBio 10:N/A (2019). PubMed: 31455651