Overview

  • Product name
  • Description
    Rabbit polyclonal to IFI44
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Chimpanzee
  • Immunogen

    Full length protein corresponding to Human IFI44 aa 1-444.
    Sequence:

    MAVTTRLTRLHEKILQNHFGGKRLSLLYKGSVHGFRNGVLLDRCCNQGPT LTVIYSEDHIIGAYAEESYQEGKYASIILFALQDTKISEWKLGLCTPETL FCCDVTKYNSPTNFQIDGRNRKVIMDLKTMENLGLAQNCTISIQDYEVFR CEDSLDERKIKGVIELRKSLLSALRTYEPYGSLVQQIRILLLGPIGAGKS SFFNSVRSVFQGHVTHQALVGTNTTGISEKYRTYSIRDGKDGKYLPFILC DSLGLSEKEGGLCRDDIFYILNGNIRDRYQFNPMESIKLNHHDYIDSPSL KDRIHCVAFVFDASSIQYFSSQMIVKIKRIRRELVNAGVVHVALLTHVDS MDLITKGDLIEIERCEPVRSKLEEVQRKLGFALSDISVVSNYSSEWELDP VKDVLILSALRRMLWAADDFLEDLPFEQIGNLREEIINCAQGKK


    Database link: NP_006408.2

  • Positive control
    • IFI44-transfected 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab172499 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 50 kDa.

Target

  • Function
    This protein aggregates to form microtubular structures.
  • Sequence similarities
    Belongs to the IFI44 family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • hepatitis C-associated microtubular aggregate protein (44kD) antibody
    • IFI 44 antibody
    • Ifi44 antibody
    • IFI44_HUMAN antibody
    • Interferon induced hepatitis C associated microtubular aggregate protein (44kD) antibody
    • Interferon induced hepatitis C associated microtubular aggregate protein antibody
    • Interferon induced protein 44 antibody
    • Interferon-induced protein 44 antibody
    • Microtubule associated protein 44 antibody
    • Microtubule-associated protein 44 antibody
    • MTAP 44 antibody
    • MTAP44 antibody
    • OTTHUMP00000011293 antibody
    • p44 antibody
    • TBC/LysM-associated domain containing 5 antibody
    • TLDC5 antibody
    see all

Images

  • All lanes : Anti-IFI44 antibody (ab172499) at 1 µg/ml

    Lane 1 : IFI44-transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Rabbit IgG (H+L) at 1/7500 dilution

    Developed using the ECL technique.

    Predicted band size: 50 kDa

References

ab172499 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172499.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up