Overview

  • Product name

  • Description

    Rabbit polyclonal to IFIT3/P60
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IF, IPmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee
  • Immunogen

    Recombinant full length protein corresponding to Human IFIT3/P60 aa 1-490.
    Sequence:

    MSEVTKNSLEKILPQLKCHFTWNLFKEDSVSRDLEDRVCNQIEFLNTEFK ATMYNLLAYIKHLDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNY AWVYYHLGRLSDAQIYVDKVKQTCKKFSNPYSIEYSELDCEEGWTQLKCG RNERAKVCFEKALEEKPNNPEFSSGLAIAMYHLDNHPEKQFSTDVLKQAI ELSPDNQYVKVLLGLKLQKMNKEAEGEQFVEEALEKSPCQTDVLRSAAKF YRRKGDLDKAIELFQRVLESTPNNGYLYHQIGCCYKAKVRQMQNTGESEA SGNKEMIEALKQYAMDYSNKALEKGLNPLNAYSDLAEFLETECYQTPFNK EVPDAEKQQSHQRYCNLQKYNGKSEDTAVQHGLEGLSISKKSTDKEEIKD QPQNVSENLLPQNAPNYWYLQGLIHKQNGDLLQAAKCYEKELGRLLRDAP SGIGSIFLSASELEDGSEEMGQGAVSSSPRELLSNSEQLN


    Database link: O14879

  • Positive control

    • WB: A549 whole cell lysate. IHC-P: Human kidney and colon cancer tissues. ICC/IF: HepG2 cells. IP: HepG2 whole cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236243 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 56 kDa.
ICC/IF 1/50 - 1/500.
IP 1/200 - 1/2000.

Target

  • Sequence similarities

    Belongs to the IFIT family.
    Contains 8 TPR repeats.
  • Information by UniProt
  • Database links

  • Alternative names

    • CIG 49 antibody
    • CIG49 antibody
    • GARG 49 antibody
    • IFI-60K antibody
    • IFI60 antibody
    • IFI60K antibody
    • IFIT-3 antibody
    • IFIT-4 antibody
    • Ifit3 antibody
    • IFIT3_HUMAN antibody
    • IFIT4 antibody
    • Interferon induced 60 kDa protein antibody
    • Interferon induced protein 60 antibody
    • Interferon induced protein with tetratricopeptide repeats 3 antibody
    • Interferon-induced 60 kDa protein antibody
    • Interferon-induced protein with tetratricopeptide repeats 3 antibody
    • Interferon-induced protein with tetratricopeptide repeats 4 antibody
    • IRG2 antibody
    • ISG-60 antibody
    • ISG60 antibody
    • P60 antibody
    • Retinoic acid induced gene G protein antibody
    • Retinoic acid-induced gene G protein antibody
    • RIG G antibody
    • RIG-G antibody
    • RIGG antibody
    • RP11-149I23.4 antibody
    see all

Images

  • Anti-IFIT3/P60 antibody (ab236243) at 1/1000 dilution + A549 (human lung carcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 56 kDa

  • Paraffin-embedded human kidney tissue stained for IFIT3/P60 using ab236243 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human colon cancer tissue stained for IFIT3/P60 using ab236243 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for IFIT3/P60 (green) using ab236243 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

  • IFIT3/P60 was immunoprecipitated from 500 µg HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate with ab236243 at 1/200 dilution. 

    Lane 1: Rabbit monoclonal IgG IP in HepG2 whole cell lysate.

    Lane 2: ab236243 IP in HepG2 whole cell lysate.

    Lane 3: HepG2 whole cell lysate 10 µg (Input).

    For western blotting, an HRP-conjugated Protein G antibody was used as the secondary antibody at 1/2000 dilution.

References

ab236243 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236243.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up