Overview

  • Product name

    Anti-IFIT3/P60 antibody [OTI1G1]
    See all IFIT3/P60 primary antibodies
  • Description

    Mouse monoclonal [OTI1G1] to IFIT3/P60
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cyt, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee
  • Immunogen

    Recombinant full length protein corresponding to Human IFIT3/P60 aa 1-490. Produced in HEK-293T cells (NP_001540).
    Sequence:

    MSEVTKNSLEKILPQLKCHFTWNLFKEDSVSRDLEDRVCNQIEFLNTEFK ATMYNLLAYIKHLDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNY AWVYYHLGRLSDAQIYVDKVKQTCKKFSNPYSIEYSELDCEEGWTQLKCG RNERAKVCFEKALEEKPNNPEFSSGLAIAMYHLDNHPEKQFSTDVLKQAI ELSPDNQYVKVLLGLKLQKMNKEAEGEQFVEEALEKSPCQTDVLRSAAKF YRRKGDLDKAIELFQRVLESTPNNGYLYHQIGCCYKAKVRQMQNTGESEA SGNKEMIEALKQYAMDYSNKALEKGLNPLNAYSDLAEFLETECYQTPFNK EVPDAEKQQSHQRYCNLQKYNGKSEDTAVQHGLEGLSISKKSTDKEEIKD QPQNVSENLLPQNAPNYWYLQGLIHKQNGDLLQAAKCYEKELGRLLRDAP SGIGSIFLSASELEDGSEEMGQGAVSSSPRELLSNSEQLN


    Database link: O14879

  • Positive control

    • WB: HepG2, HeLa, A549, COS-7, Jurkat and MCF7 extracts; HEK-293T cells transfected with pCMV6-ENTRY IFIT3/P60 cDNA. ICC/IF: COS-7 (transiently transfected by pCMV6-ENTRY IFIT3/P60 cDNA) and HT-29 cells. FC: Jurkat cells.
  • General notes

    Clone OTI1G1 (formerly 1G1).

    Protein previously labeled as IFIT3.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol, 1% BSA
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant by affinity chromatography.
  • Clonality

    Monoclonal
  • Clone number

    OTI1G1
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab118045 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 56 kDa.
Flow Cyt 1/100.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

ICC/IF 1/100.

Target

  • Sequence similarities

    Belongs to the IFIT family.
    Contains 8 TPR repeats.
  • Information by UniProt
  • Database links

  • Alternative names

    • CIG 49 antibody
    • CIG49 antibody
    • GARG 49 antibody
    • IFI-60K antibody
    • IFI60 antibody
    • IFI60K antibody
    • IFIT-3 antibody
    • IFIT-4 antibody
    • Ifit3 antibody
    • IFIT3_HUMAN antibody
    • IFIT4 antibody
    • Interferon induced 60 kDa protein antibody
    • Interferon induced protein 60 antibody
    • Interferon induced protein with tetratricopeptide repeats 3 antibody
    • Interferon-induced 60 kDa protein antibody
    • Interferon-induced protein with tetratricopeptide repeats 3 antibody
    • Interferon-induced protein with tetratricopeptide repeats 4 antibody
    • IRG2 antibody
    • ISG-60 antibody
    • ISG60 antibody
    • P60 antibody
    • Retinoic acid induced gene G protein antibody
    • Retinoic acid-induced gene G protein antibody
    • RIG G antibody
    • RIG-G antibody
    • RIGG antibody
    • RP11-149I23.4 antibody
    see all

Images

  • All lanes : Anti-IFIT3/P60 antibody [OTI1G1] (ab118045) at 1/200 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) extracts
    Lane 2 : HeLa (Human epithelial cell line from cervix adenocarcinoma) extracts
    Lane 3 : SVT2 extracts
    Lane 4 : A549 (Human lung carcinoma cell line) extracts
    Lane 5 : COS-7 (African green monkey kidney fibroblast-like cell line) extracts
    Lane 6 : Jurkat (Human T cell leukemia cell line from peripheral blood) extracts
    Lane 7 : MDCK (Canine kidney cell line) extracts
    Lane 8 : PC-12 (Rat adrenal gland pheochromocytoma cell line) extracts
    Lane 9 : MCF7 (Human breast adenocarcinoma cell line) extracts

    Lysates/proteins at 35 µg per lane.

    Predicted band size: 56 kDa

  • pCMV6-ENTRY IFIT3/P60 cDNA transfected COS-7 (African green monkey kidney fibroblast-like cell line) cells stained for IFIT3/P60 using ab118045 at a 1/100 dilution in ICC/IF.

  • ab118045 at 1/100 dilution staining IFIT3/P60 in Jurkat (Human T cell leukemia cell line from peripheral blood) cells by Flow cytometry (Red) compared to a nonspecific negative control antibody (Blue).

  • HT-29 (Human colorectal adenocarcinoma cell line) cells stained for IFIT3/P60 using ab118045 at a 1/100 dilution in ICC/IF.

  • All lanes : Anti-IFIT3/P60 antibody [OTI1G1] (ab118045) at 1/2000 dilution

    Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cells, transfected with pCMV6-ENTRY control cDNA
    Lane 2 : HEK-293T cells, transfected with pCMV6-ENTRY IFIT3/P60 cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 56 kDa

References

ab118045 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab118045.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up