Overview

  • Product name

  • Description

    Rabbit polyclonal to IFIT5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human IFIT5 aa 304-381.
    Sequence:

    THNRPKGKDKLKVDELISSAIFHFKAAMERDSMFAFAYTDLANMYAEGGQ YSNAEDIFRKALRLENITDDHKHQIHYH


    Database link: Q13325

  • Positive control

    • Human RT4 cell lysate; A431 cell line

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220954 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

WB 1/500 - 1/1000. Predicted molecular weight: 56 kDa.

Target

  • Sequence similarities

    Belongs to the IFIT family.
    Contains 8 TPR repeats.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ53857 antibody
    • FLJ92678 antibody
    • IFIT-5 antibody
    • IFIT5 antibody
    • IFIT5_HUMAN antibody
    • Interferon induced protein with tetratricopeptide repeats 5 antibody
    • Interferon-induced protein with tetratricopeptide repeats 5 antibody
    • Retinoic acid and interferon inducible 58 kDa protein antibody
    • Retinoic acid and interferon inducible protein (58kD) antibody
    • Retinoic acid- and interferon-inducible 58 kDa protein antibody
    • RI58 antibody
    see all

Images

  • Anti-IFIT5 antibody (ab220954) at 1/500 dilution + Human RT4 cell lysate

    Predicted band size: 56 kDa

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized A431 cells labeling IFIT5 with ab220954 at 4 µg/ml (green).

References

ab220954 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220954.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up