Overview

  • Product name

    Anti-IFITM2 antibody
  • Description

    Rabbit polyclonal to IFITM2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human IFITM2 aa 1-56.
    Sequence:

    MNHIVQTFSPVNSGQPPNYEMLKEEQEVAMLGVPHNPAPPMSTVIHIRSE TSVPDH


    Database link: Q01629

  • Positive control

    • WB: HeLa, MCF7, HepG2 and A549 whole cell lysates. IHC-P: Human lung cancer tissue. ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236735 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000.
WB 1/500 - 1/5000. Predicted molecular weight: 15 kDa.
ICC/IF 1/50 - 1/500.

Target

  • Relevance

    IFITM2 belongs to the CD225 family and is induced by alpha and gamma interferons.
  • Cellular localization

    Membrane; Multipass membrane protein
  • Database links

  • Alternative names

    • 1 8D antibody
    • Dispanin subfamily A member 2c antibody
    • DSPA2c antibody
    • IFITM 2 antibody
    • Interferon induced transmembrane protein 2 (1 8D) antibody
    • Interferon induced transmembrane protein 2 antibody
    • Interferon inducible protein 1 8D antibody
    see all

Images

  • All lanes : Anti-IFITM2 antibody (ab236735) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
    Lane 3 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 4 : A549 (human lung carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 15 kDa

  • Paraffin-embedded human lung cancer tissue stained for IFITM2 using ab236735 at 1/700 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for IFITM2 (green) using ab236735 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236735 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236735.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up