Overview

  • Product name

  • Description

    Rabbit polyclonal to IFIX
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Dog, Pig, African green monkey
  • Immunogen

    Synthetic peptide corresponding to Human IFIX aa 2-51 (N terminal).
    Sequence:

    ANNYKKIVLLKGLEVINDYHFRIVKSLLSNDLKLNPKMKEEYDKIQIADL


    Database link: NP_689714

  • Positive control

    • MCF7 cell lysate
  • General notes

     This product was previously labelled as PYHIN1

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab106144 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 55 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Major mediator of the tumor suppressor activity of IFN in breast cancer cells. Promotes ubiquitination and subsequent degradation of MDM2, which leads to p53/TP53 stabilization. Promotes ubiquitination and subsequent degradation of HDAC1, which in turn enhances maspin expression, and impairs invasive activity of cancer cells.
  • Tissue specificity

    Expressed in spleen, lymph node and peripheral blood leukocytes, and at lower levels in thymus, bone marrow and fetal liver. Down-regulated in breast tumors.
  • Sequence similarities

    Belongs to the HIN-200 family.
    Contains 1 DAPIN domain.
    Contains 1 HIN-200 domain.
  • Domain

    The HIN-200 domain mediates interaction with MDM2.
  • Cellular localization

    Nucleus > nucleoplasm and Nucleus. Nucleus speckle.
  • Information by UniProt
  • Database links

  • Alternative names

    • IFIX_HUMAN antibody
    • Interferon-inducible protein X antibody
    • Pyhin1 antibody
    • Pyrin and HIN domain-containing protein 1 antibody

Images

  • Anti-IFIX antibody (ab106144) at 1 µg/ml + MCF7 cell lysate at 10 µg

    Predicted band size: 55 kDa



    Gel concentration: 12%

References

ab106144 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Mouse Cell lysate - whole cell (RAW 264.7 cells)
Gel Running Conditions
Reduced Denaturing (12% gel (Acrylamide))
Loading amount
20 µg
Treatment
Interferon bete (2h, 6h, 12h, 24h)
Specification
RAW 264.7 cells
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 20°C

Abcam user community

Verified customer

Submitted Mar 17 2016

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up