Anti-IFIX antibody (ab106145)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-IFIX antibody
See all IFIX primary antibodies -
Description
Rabbit polyclonal to IFIX -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Synthetic peptide corresponding to Human IFIX aa 38-87 (N terminal).
Sequence:KMKEEYDKIQIADLMEEKFPGDAGLGKLIEFFKEIPTLGDLAETLKREKL
Database link: NP_945148 -
Positive control
- 721_B cell lysate
-
General notes
This product was previously labelled as PYHIN1
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 2% Sucrose, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab106145 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 1 µg/ml. Predicted molecular weight: 55 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T. |
Target
-
Function
Major mediator of the tumor suppressor activity of IFN in breast cancer cells. Promotes ubiquitination and subsequent degradation of MDM2, which leads to p53/TP53 stabilization. Promotes ubiquitination and subsequent degradation of HDAC1, which in turn enhances maspin expression, and impairs invasive activity of cancer cells. -
Tissue specificity
Expressed in spleen, lymph node and peripheral blood leukocytes, and at lower levels in thymus, bone marrow and fetal liver. Down-regulated in breast tumors. -
Sequence similarities
Belongs to the HIN-200 family.
Contains 1 DAPIN domain.
Contains 1 HIN-200 domain. -
Domain
The HIN-200 domain mediates interaction with MDM2. -
Cellular localization
Nucleus > nucleoplasm and Nucleus. Nucleus speckle. - Information by UniProt
-
Database links
- Entrez Gene: 149628 Human
- Omim: 612677 Human
- SwissProt: Q6K0P9 Human
- Unigene: 710248 Human
-
Alternative names
- IFIX_HUMAN antibody
- Interferon-inducible protein X antibody
- Pyhin1 antibody
- Pyrin and HIN domain-containing protein 1 antibody
Images
-
Western blot - Anti-IFIX antibody (ab106145)Anti-IFIX antibody (ab106145) at 1 µg/ml + 721_B cell lysate at 10 µg
Predicted band size: 55 kDa
Gel concentration: 12%
Protocols
Datasheets and documents
References
ab106145 has not yet been referenced specifically in any publications.
