Overview

  • Product name

    Anti-IFN-alpha-7 antibody
  • Description

    Rabbit polyclonal to IFN-alpha-7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Mouse IFN-alpha-7 aa 24-190. (Expressed in E.coli).
    Sequence:

    YDLPQTHNLRNKRALTLLVKMRRLSPLSCLKDRKDFRFPQEKVDAQQIQE AQALCVLHELTQQILNIFTSKDSSAAWDGSLLDSFCNDLHQQLNDLQGCL MQQVGVQEPPLTQEDALLAVRTYFHSITVFLREKKHSPCAWEVVRAEVWR ALSSSAKLLARLSEKKE


    Database link: Q810G6

  • Positive control

    • WB: Recombinant mouse IFN-alpha-7 protein; Mouse lymphocyte lysate.
  • General notes

    Previously labelled as IFNA7. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231139 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231139 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 22 kDa.

Target

  • Function

    Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
  • Sequence similarities

    Belongs to the alpha/beta interferon family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • IFN alpha 7 antibody
    • IFN alpha J1 antibody
    • IFN alphaJ antibody
    • IFN-alpha-7 antibody
    • IFN-alpha-J1 antibody
    • IFNA 7 antibody
    • IFNA J antibody
    • IFNA7 antibody
    • IFNA7_HUMAN antibody
    • Interferon alpha 7 antibody
    • Interferon alpha family, gene 7 antibody
    • Interferon alpha J antibody
    • Interferon alpha J1 antibody
    • Interferon alpha-7 antibody
    • Interferon alpha-J antibody
    • Interferon alpha-J1 antibody
    • LeIF J antibody
    • OTTHUMP00000021136 antibody
    • OTTMUSP00000012102 antibody
    • RP23-139P14.26 antibody
    see all

Images

  • Anti-IFN-alpha-7 antibody (ab231139) at 2 µg/ml + Recombinant mouse IFN-alpha-7 protein

    Predicted band size: 22 kDa

  • Anti-IFN-alpha-7 antibody (ab231139) at 2 µg/ml + Mouse lymphocyte lysate

    Predicted band size: 22 kDa

References

ab231139 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231139.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up