Overview

  • Product name

  • Description

    Rabbit polyclonal to IFNA4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within C terminal amino acids 140-189 (

    ILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD

    ) of Human IFNA4 (NP_066546).

  • Positive control

    • Human fetal stomach lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab135258 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 22 kDa.

Target

  • Relevance

    Produced by macrophages, IFN alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
  • Cellular localization

    Secreted
  • Database links

  • Alternative names

    • IFN-alpha-4 antibody
    • IFN-alpha4a antibody
    • INFA4 antibody
    • Interferon alpha 4 precursor antibody
    • Interferon alpha 4B antibody
    • Interferon alpha 76 antibody
    • Interferon alpha M1 antibody
    • Interferon, alpha 4 antibody
    see all

Images

  • Anti-IFNA4 antibody (ab135258) at 1 µg/ml + Human fetal stomach lysate at 10 µg

    Predicted band size: 22 kDa

References

ab135258 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab135258.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up