Anti-IFNA4 antibody (ab232899)
Key features and details
- Rabbit polyclonal to IFNA4
- Suitable for: WB, IHC-P
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-IFNA4 antibody
See all IFNA4 primary antibodies -
Description
Rabbit polyclonal to IFNA4 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant fragment (His-tag) corresponding to Human IFNA4 aa 10-163. Expressed in E.coli. N-terminal tag.
Sequence:AVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISHFSCLKDRHDF GFPEEEFDGHQFQKAQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFS TELYQQLNDLEACVIQEVGVEETPLMNEDSILAVRKYFQRITLYLTEKKY SPCA
Database link: P05014 -
Positive control
- WB: Recombinant human IFNA4 protein; Mouse lymphocyte lysate. IHC-P: Human liver tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Protein A purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab232899 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 22 kDa. | |
| IHC-P | Use a concentration of 5 - 20 µg/ml. |
Target
-
Relevance
Produced by macrophages, IFN alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. -
Cellular localization
Secreted -
Database links
- Entrez Gene: 3441 Human
- Entrez Gene: 15967 Mouse
- Omim: 147564 Human
- SwissProt: P05014 Human
- SwissProt: P07351 Mouse
- Unigene: 1510 Human
- Unigene: 377088 Mouse
-
Alternative names
- IFN-alpha-4 antibody
- IFN-alpha4a antibody
- INFA4 antibody
see all
Images
-
Western blot - Anti-IFNA4 antibody (ab232899)Anti-IFNA4 antibody (ab232899) at 2 µg/ml + Mouse lymphocyte lysate
Predicted band size: 22 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IFNA4 antibody (ab232899)Formalin-fixed, paraffin-embedded human liver tissue stained for IFNA4 using ab232899 at 20 μg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IFNA4 antibody (ab232899)Formalin-fixed, paraffin-embedded human brain tissue stained for IFNA4 using ab232899 at 20 μg/ml in immunohistochemical analysis. DAB staining.
-
Western blot - Anti-IFNA4 antibody (ab232899)Anti-IFNA4 antibody (ab232899) at 2 µg/ml + Recombinant human IFNA4 protein
Predicted band size: 22 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab232899 has not yet been referenced specifically in any publications.
