Anti-IFNA4 antibody (ab232899)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-IFNA4 antibody
See all IFNA4 primary antibodies -
Description
Rabbit polyclonal to IFNA4 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant fragment (His-tag) corresponding to Human IFNA4 aa 10-163. Expressed in E.coli. N-terminal tag.
Sequence:AVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISHFSCLKDRHDF GFPEEEFDGHQFQKAQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFS TELYQQLNDLEACVIQEVGVEETPLMNEDSILAVRKYFQRITLYLTEKKY SPCA
Database link: P05014 -
Positive control
- WB: Recombinant human IFNA4 protein; Mouse lymphocyte lysate. IHC-P: Human liver tissue.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Protein A purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab232899 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 22 kDa. | |
IHC-P | Use a concentration of 5 - 20 µg/ml. |
Target
-
Relevance
Produced by macrophages, IFN alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. -
Cellular localization
Secreted -
Database links
- Entrez Gene: 3441 Human
- Entrez Gene: 15967 Mouse
- Omim: 147564 Human
- SwissProt: P05014 Human
- SwissProt: P07351 Mouse
- Unigene: 1510 Human
- Unigene: 377088 Mouse
-
Alternative names
- IFN-alpha-4 antibody
- IFN-alpha4a antibody
- INFA4 antibody
see all
Images
-
Anti-IFNA4 antibody (ab232899) at 2 µg/ml + Mouse lymphocyte lysate
Predicted band size: 22 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IFNA4 antibody (ab232899)
Formalin-fixed, paraffin-embedded human liver tissue stained for IFNA4 using ab232899 at 20 μg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IFNA4 antibody (ab232899)
Formalin-fixed, paraffin-embedded human brain tissue stained for IFNA4 using ab232899 at 20 μg/ml in immunohistochemical analysis. DAB staining.
-
Anti-IFNA4 antibody (ab232899) at 2 µg/ml + Recombinant human IFNA4 protein
Predicted band size: 22 kDa
Datasheets and documents
References
ab232899 has not yet been referenced specifically in any publications.