For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    By product type
    Proteins and Peptides
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Lysates
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    • Protocols & troubleshooting
    • Technical FAQs
    • Get technical help
    • RabMAb Advantages
    • Buying FAQs
    • Antibody Guide
    • Scientific webinars
    • Biochemical product FAQ
    • Support resources
    • eProcurement
    Check out our protocols

    Visit protocols and troubleshooting or check them out using the Abcam app for iPhone

    Protocols and troubleshooting

    iPhone app

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    ifna4-antibody-ab232899.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Innate Immunity Cytokines Interferons
Share by email

Anti-IFNA4 antibody (ab232899)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

  • Western blot - Anti-IFNA4 antibody (ab232899)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IFNA4 antibody (ab232899)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IFNA4 antibody (ab232899)
  • Western blot - Anti-IFNA4 antibody (ab232899)

Add compatible products

Primary

Product image

 

Secondary

Product image

 

Protein

 

Unfortunately, one or more of the products below are unavailable in your country/region.

Sorry, we can't display this right now.
Please contact us to place your order, or try again later.

View more associated products

  • Datasheet
  • References
  • Protocols

Overview

  • Product name

    Anti-IFNA4 antibody
    See all IFNA4 primary antibodies
  • Description

    Rabbit polyclonal to IFNA4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human IFNA4 aa 10-163. Expressed in E.coli. N-terminal tag.
    Sequence:

    AVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISHFSCLKDRHDF GFPEEEFDGHQFQKAQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFS TELYQQLNDLEACVIQEVGVEETPLMNEDSILAVRKYFQRITLYLTEKKY SPCA


    Database link: P05014

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: Recombinant human IFNA4 protein; Mouse lymphocyte lysate. IHC-P: Human liver tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Immunology
    • Innate Immunity
    • Cytokines
    • Interferons
    • Cancer
    • Tumor immunology
    • Cytokines
    • Interferons

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
  • Recombinant Protein

    • Recombinant Human IFNA4 protein (ab191951)

Applications

Our Abpromise guarantee covers the use of ab232899 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 22 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Relevance

    Produced by macrophages, IFN alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
  • Cellular localization

    Secreted
  • Database links

    • Entrez Gene: 3441 Human
    • Entrez Gene: 15967 Mouse
    • Omim: 147564 Human
    • SwissProt: P05014 Human
    • SwissProt: P07351 Mouse
    • Unigene: 1510 Human
    • Unigene: 377088 Mouse
    • Alternative names

      • IFN-alpha-4 antibody
      • IFN-alpha4a antibody
      • INFA4 antibody
      • Interferon alpha 4 precursor antibody
      • Interferon alpha 4B antibody
      • Interferon alpha 76 antibody
      • Interferon alpha M1 antibody
      • Interferon, alpha 4 antibody
      see all

    Images

    • Western blot - Anti-IFNA4 antibody (ab232899)
      Western blot - Anti-IFNA4 antibody (ab232899)
      Anti-IFNA4 antibody (ab232899) at 2 µg/ml + Mouse lymphocyte lysate

      Predicted band size: 22 kDa

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IFNA4 antibody (ab232899)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IFNA4 antibody (ab232899)

      Formalin-fixed, paraffin-embedded human liver tissue stained for IFNA4 using ab232899 at 20 μg/ml in immunohistochemical analysis. DAB staining.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IFNA4 antibody (ab232899)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IFNA4 antibody (ab232899)

      Formalin-fixed, paraffin-embedded human brain tissue stained for IFNA4 using ab232899 at 20 μg/ml in immunohistochemical analysis. DAB staining.

    • Western blot - Anti-IFNA4 antibody (ab232899)
      Western blot - Anti-IFNA4 antibody (ab232899)
      Anti-IFNA4 antibody (ab232899) at 2 µg/ml + Recombinant human IFNA4 protein

      Predicted band size: 22 kDa

    Datasheets and documents

    • Datasheet
  • References

    ab232899 has not yet been referenced specifically in any publications.

    Publishing research using ab232899? Please let us know so that we can cite the reference in this datasheet.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab232899.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & advice
    • Buying FAQs
    • RabMAb products
    • Biochemical product FAQs
    Company
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2019 Abcam plc. All rights reserved.