Overview

  • Product name

    Anti-IFNA5 antibody
  • Description

    Rabbit polyclonal to IFNA5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat IFNA5 aa 24-189. Expressed in E. coli.
    Sequence:

    MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFCALLQQQSLRNKRA LTFLTQIRRFSPVSCLKDRKDFGFPLEKMDAQQIQKTQAIPILYELTQQV LNIFTSKDSSAAWDATLLDSFCNNLHQQLNDLKACLMQQSGVQEPPLTQE DSLLYVKEYFHRISVYLREKKHSPCAWEVVRAEVWRALSSSAKLLTRQSK EE


    Database link: D3ZLZ2

  • Positive control

    • IHC-P: Rat liver tissue. WB: Recombinant rat IFNA5 protein; Mouse lymphocyte lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231154 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 22 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • Formalin-fixed, paraffin-embedded rat liver tissue stained for IFNA5 with ab231154 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-IFNA5 antibody (ab231154) at 2 µg/ml + Mouse lymphocyte lysate

    Predicted band size: 22 kDa

  • Anti-IFNA5 antibody (ab231154) at 2 µg/ml + Recombinant rat IFNA5 protein

    Predicted band size: 22 kDa

References

ab231154 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231154.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up