Overview

  • Product name

  • Description

    Rabbit polyclonal to IFNAR2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Mouse IFNAR2 aa 180-230 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    SVRKKHEPKVNNVTGNFTFVLRDLLPKTNYCVSLYFDDDPAIKSPLKCIV L


    Database link: O35664

  • Positive control

    • Rat brain and testis tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab204126 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

When using a fluorescent probe the recommended dilution is 1/50 – 1/200.

WB 1/100 - 1/1000. Predicted molecular weight: 57 kDa.

Target

  • Function

    Associates with IFNAR1 to form the type I interferon receptor. Receptor for interferons alpha and beta. Involved in IFN-mediated STAT1, STAT2 and STAT3 activation. Isoform 1 and isoform 2 are directly involved in signal transduction due to their association with the TYR kinase, JAK1. Isoform 3 is a potent inhibitor of type I IFN receptor activity.
  • Tissue specificity

    Isoform 3 is detected in the urine (at protein level). Expressed in blood cells. Expressed in lymphoblastoid and fibrosarcoma cell lines.
  • Sequence similarities

    Belongs to the type II cytokine receptor family.
  • Post-translational
    modifications

    Phosphorylated on tyrosine residues upon interferon binding. Phosphorylation at Tyr-337 or Tyr-512 are sufficient to mediate interferon dependent activation of STAT1, STAT2 and STAT3 leading to antiproliferative effects on many different cell types.
    Glycosylated.
  • Cellular localization

    Secreted and Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Human interferon alpha/beta receptor antibody
    • IFN alpha REC antibody
    • IFN R antibody
    • IFN-a/ßR2 antibody
    • IFN-a/ßRß antibody
    • IFN-alpha binding protein antibody
    • IFN-alpha/beta receptor 2 antibody
    • IFN-R-2 antibody
    • IFNABR antibody
    • IFNAR2 antibody
    • IFNARB antibody
    • IFNR antibody
    • INAR2_HUMAN antibody
    • Interferon (alpha beta and omega) receptor 2 antibody
    • Interferon alpha binding protein antibody
    • Interferon alpha/beta receptor 2 antibody
    • Interferon alpha/beta receptor beta chain antibody
    • Type I interferon receptor 2 antibody
    • Type I interferon receptor antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat testis tissue labeling IFNAR2 with ab204126 at 1/200 dilution followed by Goat Anti-Rabbit IgG, Cy3 conjugated secondary antibody at 1/200 dilution.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat testis tissue labeling IFNAR2 with ab204126 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling IFNAR2 with ab204126 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

References

ab204126 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204126.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up