Overview

  • Product name

    Anti-IFNAR2 antibody - N-terminal
    See all IFNAR2 primary antibodies
  • Description

    Rabbit polyclonal to IFNAR2 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human IFNAR2 aa 41-90 (N terminal). The exact sequence is proprietary.
    Sequence:

    FKISLRNFRSILSWELKNHSIVPTHYTLLYTIMSKPEDLKVVKNCANTTR


    Database link: P48551

  • Positive control

    • AD293 cell extract.

Properties

Applications

Our Abpromise guarantee covers the use of ab190664 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 57 kDa.

Target

  • Function

    Associates with IFNAR1 to form the type I interferon receptor. Receptor for interferons alpha and beta. Involved in IFN-mediated STAT1, STAT2 and STAT3 activation. Isoform 1 and isoform 2 are directly involved in signal transduction due to their association with the TYR kinase, JAK1. Isoform 3 is a potent inhibitor of type I IFN receptor activity.
  • Tissue specificity

    Isoform 3 is detected in the urine (at protein level). Expressed in blood cells. Expressed in lymphoblastoid and fibrosarcoma cell lines.
  • Sequence similarities

    Belongs to the type II cytokine receptor family.
  • Post-translational
    modifications

    Phosphorylated on tyrosine residues upon interferon binding. Phosphorylation at Tyr-337 or Tyr-512 are sufficient to mediate interferon dependent activation of STAT1, STAT2 and STAT3 leading to antiproliferative effects on many different cell types.
    Glycosylated.
  • Cellular localization

    Secreted and Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Human interferon alpha/beta receptor antibody
    • IFN alpha REC antibody
    • IFN R antibody
    • IFN-a/ßR2 antibody
    • IFN-a/ßRß antibody
    • IFN-alpha binding protein antibody
    • IFN-alpha/beta receptor 2 antibody
    • IFN-R-2 antibody
    • IFNABR antibody
    • IFNAR2 antibody
    • IFNARB antibody
    • IFNR antibody
    • INAR2_HUMAN antibody
    • Interferon (alpha beta and omega) receptor 2 antibody
    • Interferon alpha binding protein antibody
    • Interferon alpha/beta receptor 2 antibody
    • Interferon alpha/beta receptor beta chain antibody
    • Type I interferon receptor 2 antibody
    • Type I interferon receptor antibody
    see all

Images

  • Anti-IFNAR2 antibody - N-terminal (ab190664) at 1/500 dilution + AD293 cell extract at 30 µg

    Predicted band size: 57 kDa

References

ab190664 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190664.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up