Overview

  • Product name

  • Description

    Rabbit polyclonal to IFT81
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human IFT81 aa 297-391.
    Sequence:

    KVVSEPAMGHSDLLELESKINEINTEINQLIEKKMMRNEPIEGKLSLYRQ QASIISRKKEAKAEELQEAKEKLASLEREASVKRNQTREFDGTEV


    Database link: Q8WYA0

  • Positive control

    • IHC-P: Human fallopian tube tissue. WB: RT4, NIH/3T3, NBT-II and U-251 MG cell lysate. ICC/IF: U-251 MG cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab244369 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.4 µg/ml.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Isoform CDV-1 may be involved in cardiac hypertrophy caused by carnitine deficiency.
    Isoform CDV-1R appears to play a role in development of the testis and spermatogenesis.
  • Tissue specificity

    Highly expressed in testis, moderately in ovary, heart, liver, skeletal muscle, kidney and pancreas, low in prostate, brain, placenta and lung and not detected in spleen, thymus, small intestine and colon. Isoform CDV-1R is abundantly expressed in testis.
  • Information by UniProt
  • Database links

  • Alternative names

    • Carnitine deficiency associated expressed in ventricle 1 isoform 2 antibody
    • Carnitine deficiency-associated protein expressed in ventricle 1 antibody
    • CDV-1 antibody
    • CDV1 antibody
    • CDV1R antibody
    • Ift81 antibody
    • IFT81_HUMAN antibody
    • intraflagellar transport 81 homolog (Chlamydomonas) antibody
    • Intraflagellar transport protein 81 homolog antibody
    see all

Images

  • PFA fixed, Triton X-100 permeabilized U-251 MG (Human brain glioma cell line) cells labeling IFT81 using ab244369 at 4 µg/ml (green) in ICC/IF.

  • Formalin-fixed, paraffin-embedded human fallopian tube tissue stained for IFT81 with ab244369 at a 1/50 dilution in immunohistochemical analysis.

  • All lanes : Anti-IFT81 antibody (ab244369) at 0.4 µg/ml

    Lane 1 : NIH/3T3 (Mouse embryo fibroblast cell line) cell lysate
    Lane 2 : NBT-II (Rat cell line) cell lysate
  • All lanes : Anti-IFT81 antibody (ab244369) at 0.4 µg/ml

    Lane 1 : RT4 (Human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (Human brain glioma cell line) cell lysate

References

ab244369 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244369.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up