Recombinant

Recombinant Anti-IgD antibody [RM123] (Biotin) (ab224182)

Overview

  • Product name

    Anti-IgD antibody [RM123] (Biotin)
    See all IgD primary antibodies
  • Description

    Rabbit monoclonal [RM123] to IgD (Biotin)
  • Host species

    Rabbit
  • Conjugation

    Biotin
  • Specificity

    ab224182 reacts to human IgD. No cross reactivity with human IgG, IgM, IgA, or IgE.
  • Tested applications

    Suitable for: Sandwich ELISA, ELISA, IHCmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Full length native protein (purified) corresponding to Human IgD aa 1-384.
    Sequence:

    APTKAPDVFPIISGCRHPKDNSPVVLACLITGYHPTSVTVTWYMGTQSQP QRTFPEIQRRDSYYMTSSQLSTPLQQWRQGEYKCVVQHTASKSKKEIFRW PESPKAQASSVPTAQPQAEGSLAKATTAPATTRNTGRGGEEKKKEKEKEE QEERETKTPECPSHTQPLGVYLLTPAVQDLWLRDKATFTCFVVGSDLKDA HLTWEVAGKVPTGGVEEGLLERHSNGSQSQHSRLTLPRSLWNAGTSVTCT LNHPSLPPQRLMALREPAAQAPVKLSLNLLASSDPPEAASWLLCEVSGFS PPNILLMWLEDQREVNTSGFAPARPPPQPGSTTFWAWSVLRVPAPPSPQP ATYTCVVSHEDSRTLLNASRSLEVSYVTDHGPMK


    Database link: P01880

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Stable for 12 months at -20°C. Store In the Dark.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 1% BSA, 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    ab224182 was purified from an animal origin–free culture supernatant .
  • Clonality

    Monoclonal
  • Clone number

    RM123
  • Isotype

    IgG
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab224182 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Sandwich ELISA Use at an assay dependent concentration.

Use: 25 - 200 ng/well (for capture); 0.01 - 0.1 μg/ml (for detection).

ELISA Use at an assay dependent concentration.
IHC Use a concentration of 0.5 - 2 µg/ml.

Target

  • Relevance

    Little is known about the normal function of IgD, and few clinical signs or symptoms are associated with its absence. Individuals with low or absent levels of IgD do not appear unusually predisposed to infections. In mice, IgD may substitute for some functions of IgM when IgM is absent. IgD is expressed on peripheral B cells and is used as a pan B cell marker.
  • Cellular localization

    Cytoplasmic
  • Database links

  • Alternative names

    • Ig delta chain C region antibody
    • IGHD antibody
    • Immunoglobulin heavy constant delta antibody

Images

  • Sandwich ELISA using ab224182 as the capture antibody (100 ng/well), and ab193185 as the detection antibody, followed by an alkaline phosphatase-conjugated streptavidin.

  • A titre ELISA using ab224182. The plate was coated with different amounts of human IgD from plasma. A serial dilution of ab224182 was used as primary antibody. An alkaline phosphatase-conjugated Anti-Rabbit IgG was used as secondary antibody.

  • ELISA of human immunoglobulins shows that ab224182 reacts to IgD from human plasma and IgDκ from human melanoma. No cross reactivity with human IgG, IgM, IgA or IgE. The plate was coated with 50 ng/well of the different immunoglobulins. 200 ng/ml, 50 ng/ml or 10 ng/ml of ab224182 was used as the primary antibody. An alkaline phosphatase-conjugated Anti-Rabbit IgG was used as secondary antibody.

  • Human lymphoid tissue stained for IgD with ab224182 (2 μg/ml) in immunohistochemical analysis.

References

ab224182 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224182.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up