Overview

  • Product name

    Anti-IgE antibody [RM122]
    See all IgE primary antibodies
  • Description

    Rabbit monoclonal [RM122] to IgE
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, Sandwich ELISA, ICC, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Full length native protein (purified) corresponding to Human IgE aa 1-428. IgE purified from Human myeloma plasma.
    Sequence:

    ASTQSPSVFPLTRCCKNIPSNATSVTLGCLATGYFPEPVMVTWDTGSLNG TTMTLPATTLTLSGHYATISLLTVSGAWAKQMFTCRVAHTPSSTDWVDNK TFSVCSRDFTPPTVKILQSSCDGGGHFPPTIQLLCLVSGYTPGTINITWL EDGQVMDVDLSTASTTQEGELASTQSELTLSQKHWLSDRTYTCQVTYQGH TFEDSTKKCADSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGT VNLTWSRASGKPVNHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCR VTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNF MPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQK DEFICRAVHEAASPSQTVQR AVSVNPGK


    Database link: P01854

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 1% BSA, 48% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    ab195580 was purified from an animal origin–free culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    RM122
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab195580 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 0.5 - 2 µg/ml.
Sandwich ELISA Use at an assay dependent concentration.

10 ng/well – 100 ng/well (for Capture); 0.01 µg/mL – 0.1 µg/mL (for Detection)

ICC Use a concentration of 0.5 - 2 µg/ml.
Flow Cyt Use at an assay dependent concentration.

ab172730 - Rabbit monoclonal IgG, is suitable for use as an isotype control with this antibody.

 

Target

  • Relevance

    IgE is the class of antibodies produced in the lungs, skin, and mucous membranes. It may protect against parasite invasion, but it is a major factor in allergic reactions. The antigen-specific IgE interacts with mast cells and eosinophils, triggers the release of histamine, leukotrienes and other substances that lead to the itching, sneezing and congestion of allergies - and the life threatening respiratory distress of asthma and anaphylactic shock.
  • Cellular localization

    Cell Membrane
  • Database links

  • Alternative names

    • Igh2 antibody
    • IGHE antibody
    • IGHEP1 antibody
    • Immunoglobulin heavy constant epsilon antibody

Images

  • Sandwich ELISA using ab195580 as the capture antibody (25 ng/well), and biotinylated anti-Human light chains ( κ+ λ) antibody clone RM129 as the detection antibody, followed by an alkaline phosphatase conjugated streptavidin.

References

ab195580 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab195580.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up