Anti-IGFBP1 antibody (ab231259)
Key features and details
- Rabbit polyclonal to IGFBP1
- Suitable for: WB
- Reacts with: Pig
- Isotype: IgG
Overview
-
Product name
Anti-IGFBP1 antibody
See all IGFBP1 primary antibodies -
Description
Rabbit polyclonal to IGFBP1 -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Pig -
Immunogen
Recombinant fragment (His-T7-tag) corresponding to Pig IGFBP1 aa 112-262. Expressed in E.coli. N-terminal tags.
Sequence:EATETKDPAAPETTSPESTEMTQEQLLDSFHLMATSSEDLPILWNAINNY ESMKALEATDIKKWKEPCQRELYKVLDRLAREQQKAGDRLYKFYLPNCNK NGFYHSKQCETSLEGEPGLCWCVYPWSGKKILGSTAVRGDPKCHQYFNSQ N
Database link: Q75ZP3 -
Positive control
- WB: Recombinant pig IGFBP1 protein; Pig liver, kidney and human placenta lysates.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Protein A purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab231259 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.5 - 2 µg/ml. |
Target
-
Function
IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration. -
Sequence similarities
Contains 1 IGFBP N-terminal domain.
Contains 1 thyroglobulin type-1 domain. -
Post-translational
modificationsPhosphorylated; probably by casein kinase II. Alters the affinity of the protein for IGFs. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 397270 Pig
- SwissProt: Q75ZP3 Pig
-
Alternative names
- AFBP antibody
- Alpha pregnancy associated endometrial globulin antibody
- Amniotic fluid binding protein antibody
see all
Images
-
Western blot - Anti-IGFBP1 antibody (ab231259)Anti-IGFBP1 antibody (ab231259) at 2 µg/ml + Pig liver lysate -
Western blot - Anti-IGFBP1 antibody (ab231259)Anti-IGFBP1 antibody (ab231259) at 2 µg/ml + Pig kidney lysate -
Western blot - Anti-IGFBP1 antibody (ab231259)Anti-IGFBP1 antibody (ab231259) at 2 µg/ml + Human placenta tissue lysate -
Western blot - Anti-IGFBP1 antibody (ab231259)Anti-IGFBP1 antibody (ab231259) at 2 µg/ml + Recombinant pig IGFBP1 protein
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab231259 has not yet been referenced specifically in any publications.
