Overview

  • Product name

  • Description

    Rabbit polyclonal to IGFBP3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Cow
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Cow IGFBP3 aa 106-241. Expressed in E. coli.
    Sequence:

    MGSSHHHHHHSSGLVPRGSHMASMTGGQQM GRGS-LQALLDGRGLCANASAVGRLRPYLLPSASGNGSESEEDHSMGSTE NQAGPSTHRVPVSKFHPIHTKMDVIKKGHAKDSQRYKVDYESQSTDTQNF SSESKRETEYGPCRREMEDTLNHLKFLNMLSPRGIHIPNCD


    Database link: P20959

  • Positive control

    • WB: Recombinant cow IGFBP3 protein. Mouse liver lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab231033 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml.

Target

  • Function

    IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.
  • Tissue specificity

    Expressed by most tissues. Present in plasma.
  • Sequence similarities

    Contains 1 IGFBP N-terminal domain.
    Contains 1 thyroglobulin type-1 domain.
  • Developmental stage

    IGFBP3 levels are higher during extrauterine life and peak during puberty.
  • Domain

    The thyroglobulin type-1 domain mediates interaction with HN.
  • Post-translational
    modifications

    Phosphorylation sites are present in the extracelllular medium.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Acid stable subunit of the 140 K IGF complex antibody
    • Binding protein 29 antibody
    • Binding protein 53 antibody
    • BP 53 antibody
    • BP53 antibody
    • Growth hormone dependent binding protein antibody
    • IBP 3 antibody
    • IBP-3 antibody
    • IBP3 antibody
    • IBP3_HUMAN antibody
    • IGF binding protein 3 antibody
    • IGF-binding protein 3 antibody
    • IGFBP 3 antibody
    • IGFBP-3 antibody
    • IGFBP3 antibody
    • Insulin Like Growth Factor Binding Protein 3 antibody
    • Insulin-like growth factor binding protein 3 precursor antibody
    • Insulin-like growth factor-binding protein 3 antibody
    see all

Images

  • Anti-IGFBP3 antibody (ab231033) at 2 µg/ml + mouse liver lysate

    Developed using the ECL technique.
  • Anti-IGFBP3 antibody (ab231033) at 2 µg/ml + recombinant cow IGFBP3 protein

    Developed using the ECL technique.

References

ab231033 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231033.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up