Overview

  • Product name

    Anti-IGFBP4 antibody [C15]
    See all IGFBP4 primary antibodies
  • Description

    Mouse monoclonal [C15] to IGFBP4
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Sheep, Cow, Pig
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Human IGFBP4 aa 22-258. N- terminal tag (Expressed in E.coli).
    Sequence:

    DEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCALGLGMPCGVYT PRCGSGLRCYPPRGVEKPLHTLMHGQGVCMELAEIEAIQESLQPSDKDEG DHPNNSFSPCSAHDRRCLQKHFAKIRDRSTSGGKMKVNGAPREDARPVPQ GSCQSELHRALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDG QRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFRE


    Database link: P22692

  • Positive control

    • IHC-P: Human liver and colon tissues. WB: Rat placenta and uterus lysates; Recombinant human IGFBP4 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab239594 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 28 kDa.
IHC-P Use a concentration of 5 - 30 µg/ml.

Target

Images

  • Paraffin-embedded human colon tissue stained for IGFBP4 using ab239594 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-IGFBP4 antibody [C15] (ab239594) at 2 µg/ml + Rat placenta lysate

    Secondary
    HRP-Goat Anti-Mouse IgG at 0.2 µg/ml

    Predicted band size: 28 kDa

  • Paraffin-embedded human liver tissue stained for IGFBP4 using ab239594 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-IGFBP4 antibody [C15] (ab239594) at 2 µg/ml + Rat uterus lysate

    Secondary
    HRP-Goat Anti-Mouse IgG at 0.2 µg/ml

    Predicted band size: 28 kDa

  • Anti-IGFBP4 antibody [C15] (ab239594) at 5 µg/ml + Recombinant human IGFBP4 protein

    Predicted band size: 28 kDa

References

ab239594 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239594.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up