Anti-IGFBP5 antibody (ab216622)
Key features and details
- Rabbit polyclonal to IGFBP5
- Suitable for: IHC-P
- Reacts with: Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-IGFBP5 antibody
See all IGFBP5 primary antibodies -
Description
Rabbit polyclonal to IGFBP5 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Rat, Human
Predicted to work with: Mouse -
Immunogen
Synthetic peptide within Human IGFBP5 aa 90-140 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
Sequence:LHALLHGRGVCLNEKSYREQVKIERDSREHEEPTTSEMAEETYSPKIFRP K
Database link: P24593 -
Positive control
- Human nasopharyngeal carcinoma tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 50% Glycerol, 1% BSA -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab216622 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/100 - 1/500. |
Target
-
Function
IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. -
Tissue specificity
Osteosarcoma, and at lower levels in liver, kidney and brain. -
Sequence similarities
Contains 1 IGFBP N-terminal domain.
Contains 1 thyroglobulin type-1 domain. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 3488 Human
- Entrez Gene: 16011 Mouse
- Entrez Gene: 25285 Rat
- Omim: 146734 Human
- SwissProt: P24593 Human
- SwissProt: Q07079 Mouse
- SwissProt: P24594 Rat
- Unigene: 607212 Human
see all -
Alternative names
- IBP 5 antibody
- IBP-5 antibody
- IBP5 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IGFBP5 antibody (ab216622)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded human nasopharyngeal carcinoma tissue labeling IGFBP5 with ab216622 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.
Datasheets and documents
References (0)
ab216622 has not yet been referenced specifically in any publications.