Overview

  • Product name

  • Description

    Rabbit polyclonal to IGFL3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human IGFL3 aa 25-125. Full length mature chain without signal peptide.
    Sequence:

    TTDAPVGSGLWLCQPTPRCGNKIYNPSEQCCYDDAILSLKETRRCGSTCT FWPCFELCCPESFGPQQKFLVKLRVLGMKSQCHLSPISRSCTRNRRHVLY P


    Database link: Q6UXB1

  • Positive control

    • IHC-P: Human kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab234779 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Potential ligand of the IGFLR1 cell membrane receptor.
  • Tissue specificity

    Detected in the cerebellum.
  • Sequence similarities

    Belongs to the IGFL family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • IGF like family member 3 antibody
    • IGFL3 antibody
    • IGFL3_HUMAN antibody
    • Insulin growth factor-like family member 3 antibody
    • RPRC483 antibody
    • UNQ483 antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for IGFL3 using ab234779 at 1/100 dilution in immunohistochemical analysis.

References

ab234779 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234779.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up