Anti-IgG4 antibody (ab232869)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-IgG4 antibody
See all IgG4 primary antibodies -
Description
Rabbit polyclonal to IgG4 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Human, Pig -
Immunogen
Recombinant fragment corresponding to Human IgG4 aa 222-327. Expressed in E.coli.
Sequence:QPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY KTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSL SLSLGK
Database link: P01861 -
Positive control
- WB: Recombinant human IgG4; human, pig and mouse serum. IHC-P: Human prostate cancer, glioma, kidney and stomach tissue.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab232869 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | Use a concentration of 5 - 20 µg/ml. | |
| WB | Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 36 kDa. |
Target
-
Relevance
IgG4 antibodies will dominate the IgG response in schistosomiasis, lymphatic filariasis, and in patients after allergen immunotherapy. Unlike the other IgG subclasses, IgG4 does not activate complement. A combined IgA-IgG4 deficiency has been associated with recurrent pyogenic infections. -
Cellular localization
Secreted -
Database links
- Entrez Gene: 3503 Human
- Omim: 147130 Human
- SwissProt: P01861 Human
- Unigene: 510635 Human
-
Alternative names
- Ig gamma 4 chain C region antibody
- IGHG4 antibody
- immunoglobulin heavy chain constant region gamma 4 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IgG4 antibody (ab232869)Formalin-fixed, paraffin-embedded human prostate cancer tissue stained for IgG4 using ab232869 at 20μg/ml in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IgG4 antibody (ab232869)Formalin-fixed, paraffin-embedded human glioma tissue stained for IgG4 using ab232869 at 20μg/ml in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IgG4 antibody (ab232869)Formalin-fixed, paraffin-embedded human kidney tissue stained for IgG4 using ab232869 at 20μg/ml in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IgG4 antibody (ab232869)Formalin-fixed, paraffin-embedded human stomach tissue stained for IgG4 using ab232869 at 20μg/ml in immunohistochemical analysis.
-
Western blot - Anti-IgG4 antibody (ab232869)Anti-IgG4 antibody (ab232869) at 3 µg/ml + Recombinant human IgG4
Secondary
HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
Developed using the ECL technique.
Predicted band size: 36 kDa -
Western blot - Anti-IgG4 antibody (ab232869)All lanes : Anti-IgG4 antibody (ab232869) at 3 µg/ml
Lane 1 : Human serum
Lane 2 : Pig serum
Lane 3 : Mouse serum
Secondary
All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
Developed using the ECL technique.
Predicted band size: 36 kDa
Datasheets and documents
References
ab232869 has not yet been referenced specifically in any publications.
