Anti-IgG4 antibody (ab232869)
Key features and details
- Rabbit polyclonal to IgG4
- Suitable for: IHC-P, WB
- Reacts with: Mouse, Human, Pig
- Isotype: IgG
Overview
-
Product name
Anti-IgG4 antibody
See all IgG4 primary antibodies -
Description
Rabbit polyclonal to IgG4 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Human, Pig -
Immunogen
Recombinant fragment corresponding to Human IgG4 aa 222-327. Expressed in E.coli.
Sequence:QPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY KTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSL SLSLGK
Database link: P01861 -
Positive control
- WB: Recombinant human IgG4; human, pig and mouse serum. IHC-P: Human prostate cancer, glioma, kidney and stomach tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab232869 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | Use a concentration of 5 - 20 µg/ml. | |
WB | Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 36 kDa. |
Target
-
Relevance
IgG4 antibodies will dominate the IgG response in schistosomiasis, lymphatic filariasis, and in patients after allergen immunotherapy. Unlike the other IgG subclasses, IgG4 does not activate complement. A combined IgA-IgG4 deficiency has been associated with recurrent pyogenic infections. -
Cellular localization
Secreted -
Database links
- Entrez Gene: 3503 Human
- Omim: 147130 Human
- SwissProt: P01861 Human
- Unigene: 510635 Human
-
Alternative names
- Ig gamma 4 chain C region antibody
- IGHG4 antibody
- immunoglobulin heavy chain constant region gamma 4 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IgG4 antibody (ab232869)
Formalin-fixed, paraffin-embedded human prostate cancer tissue stained for IgG4 using ab232869 at 20μg/ml in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IgG4 antibody (ab232869)
Formalin-fixed, paraffin-embedded human glioma tissue stained for IgG4 using ab232869 at 20μg/ml in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IgG4 antibody (ab232869)
Formalin-fixed, paraffin-embedded human kidney tissue stained for IgG4 using ab232869 at 20μg/ml in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IgG4 antibody (ab232869)
Formalin-fixed, paraffin-embedded human stomach tissue stained for IgG4 using ab232869 at 20μg/ml in immunohistochemical analysis.
-
Anti-IgG4 antibody (ab232869) at 3 µg/ml + Recombinant human IgG4
Secondary
HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
Developed using the ECL technique.
Predicted band size: 36 kDa -
All lanes : Anti-IgG4 antibody (ab232869) at 3 µg/ml
Lane 1 : Human serum
Lane 2 : Pig serum
Lane 3 : Mouse serum
Secondary
All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
Developed using the ECL technique.
Predicted band size: 36 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab232869 has not yet been referenced specifically in any publications.