Recombinant

Recombinant Anti-IgG4 antibody [IGHG4/2042R] - BSA and Azide free (ab237849)

Overview

  • Product name

    Anti-IgG4 antibody [IGHG4/2042R] - BSA and Azide free
    See all IgG4 primary antibodies
  • Description

    Rabbit monoclonal [IGHG4/2042R] to IgG4 - BSA and Azide free
  • Host species

    Rabbit
  • Tested applications

    Suitable for: Protein Array, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human IgG4 aa 1-327.
    Sequence:

    ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGV HTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVES KYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQED PEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYK CKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVK GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEG NVFSCSVMHEALHNHYTQKSLSLSLGK


    Database link: P01861

  • Positive control

    • IHC-P: Human tonsil tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab237849 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Protein Array Use at an assay dependent concentration.
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Incubate with primary antibody for 30 minutes at RT

Target

  • Relevance

    IgG4 antibodies will dominate the IgG response in schistosomiasis, lymphatic filariasis, and in patients after allergen immunotherapy. Unlike the other IgG subclasses, IgG4 does not activate complement. A combined IgA-IgG4 deficiency has been associated with recurrent pyogenic infections.
  • Cellular localization

    Secreted
  • Database links

  • Alternative names

    • Ig gamma 4 chain C region antibody
    • IGHG4 antibody
    • immunoglobulin heavy chain constant region gamma 4 antibody
    • Immunoglobulin heavy constant gamma 4 (G4m marker) antibody
    • MGC117419 antibody
    see all

Images

  • This data was produced with ab238005, the same antibody in a different formulation with BSA and Azide.
    ab238005 was tested in protein array against over 19000 different full-length human proteins.
    Z- and S- Score: The Z-score represents the strength of a signal that a monoclonal antibody (MAb) (in combination with a fluorescently-tagged anti-IgG secondary antibody) produces when binding to a particular protein on the HuProtTM array. Z-scores are described in units of standard deviations (SD's) above the mean value of all signals generated on that array. If targets on HuProtTM are arranged in descending order of the Z-score, the S-score is the difference (also in units of SD's) between the Z-score. S-score therefore represents the relative target specificity of a MAb to its intended target.
    A MAb is specific to its intended target if the MAb has an S-score of at least 2.5. For example, if a MAb binds to protein X with a Z-score of 43 and to protein Y with a Z-score of 14, then the S-score for the binding of that MAb to protein X is equal to 29.
  • Formalin-fixed, paraffin-embedded human tonsil tissue stained for IgG4 using ab237849 at 1 μg/ml in immunohistochemical analysis.

References

ab237849 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237849.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up