Anti-IGJ antibody [KT109] (ab169854)
Key features and details
- Mouse monoclonal [KT109] to IGJ
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG2b
Overview
-
Product name
Anti-IGJ antibody [KT109]
See all IGJ primary antibodies -
Description
Mouse monoclonal [KT109] to IGJ -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human IGJ aa 1-159.
Sequence:MKNHLLFWGVLAVFIKAVHVKAQEDERIVLVDNKCKCARITSRIIRSSED PNEDIVERNIRIIVPLNNRENISDPTSPLRTRFVYHLSDLCKKCDPTEVE LDNQIVTATQSNICDEDSATETCYTYDRNKCYTAVVPLVYGGETKMVETA LTPDACYPD
Database link: P01591 -
Positive control
- Purified serum IgA; Human saliva
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.1% Sodium azide
Constituent: 99.9% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Monoclonal -
Clone number
KT109 -
Isotype
IgG2b -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab169854 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
Use a concentration of 1 µg/ml. Predicted molecular weight: 18 kDa.
|
Notes |
---|
WB
Use a concentration of 1 µg/ml. Predicted molecular weight: 18 kDa. |
Target
-
Function
Serves to link two monomer units of either IgM or IgA. In the case of IgM, the J chain-joined dimer is a nucleating unit for the IgM pentamer, and in the case of IgA it induces larger polymers. It also help to bind these immunoglobulins to secretory component. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 3512 Human
- Omim: 147790 Human
- SwissProt: P01591 Human
- Unigene: 643431 Human
-
Alternative names
- IGCJ antibody
- IGJ_HUMAN antibody
- Immunoglobulin J chain antibody
see all
Images
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab169854 has not yet been referenced specifically in any publications.