Overview

  • Product name

    Anti-IGLC2 antibody [5E12B9]
    See all IGLC2 primary antibodies
  • Description

    Mouse monoclonal [5E12B9] to IGLC2
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human IGLC2 aa 1-106. Expressed in E. coli.
    Sequence:

    GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVK AGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTV APTECS


    Database link: P01842

  • Positive control

    • WB: Recombinant human IGLC2 protein (amino acids 1-106). IGLC2 (amino acids: 1-106) - hIgGFc transfected HEK-293 cell lysate. IHC-P: Human colon tissue and endometrial cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from TCS.
  • Clonality

    Monoclonal
  • Clone number

    5E12B9
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233563 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 11 kDa.
IHC-P 1/200 - 1/1000.

Target

  • Database links

  • Alternative names

    • Ig lambda chain C regions antibody
    • IGLC antibody
    • immunoglobulin lambda constant region 2 (Kern- Oz- marker) antibody
    • MGC20392 antibody
    • MGC45681 antibody
    • partial Ke Oz polypeptide antibody
    see all

Images

  • All lanes : Anti-IGLC2 antibody [5E12B9] (ab233563) at 1/500 dilution

    Lane 1 : HEK-293 (Human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : IGLC2 (amino acids: 1-106) - hIgGFc transfected HEK-293 (Human epithelial cell line from embryonic kidney) cell lysate

    Predicted band size: 11 kDa

  • Paraffin-embedded human endometrial cancer tissue stained for IGLC2 with ab233563 at a 1/200 dilution in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human colon tissue stained for IGLC2 with ab233563 at a 1/200 dilution in immunohistochemical analysis. DAB staining.

  • Anti-IGLC2 antibody [5E12B9] (ab233563) at 1/500 dilution + Recombinant human IGLC2 protein (amino acids 1-106)

    Predicted band size: 11 kDa



    (Expected MW is 36.8 kDa)

References

ab233563 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233563.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up