Overview

  • Product name

    Anti-IGSF1/p120 antibody
  • Description

    Rabbit polyclonal to IGSF1/p120
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISA, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to Human IGSF1/p120 aa 151-200 (N terminal).
    Sequence:

    LCHGWLQDLVFMLFKEGYAEPVDYQVPTGTMAIFSIDNLTPEDEGVYICR

  • Positive control

    • WB: HepG2 cell lysate IHC-P: Human kidney tissue
  • General notes

    Product previously known as Anti-IGSF1 antibody.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab66509 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1.25 µg/ml. Detects a band of approximately 27 kDa (predicted molecular weight: 148 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/312500.

IHC-P Use a concentration of 4 - 8 µg/ml.

Target

  • Function

    Seems to be a coreceptor in inhibin signaling, but seems not to be a high-affinity inhibin receptor. Antagonizes activin A signaling in the presence or absence of inhibin B (By similarity). Necessary to mediate a specific antagonistic effect of inhibin B on activin-stimulated transcription.
  • Tissue specificity

    Highly expressed in pancreas, testis and fetal liver. Moderately expressed in heart, prostate and small intestine. Expressed at very low levels in brain, thymus, ovary, colon, fetal lung and fetal kidney. Expressed in muscle. Isoform 3 is expressed in pituitary gland.
  • Involvement in disease

    Hypothyroidism, central, and testicular enlargement
  • Sequence similarities

    Contains 12 Ig-like C2-type (immunoglobulin-like) domains.
  • Developmental stage

    Expressed in embryo Carnegie stage 18 in Rathke's pouch progenitors.
  • Cellular localization

    Secreted and Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • IGCD1 antibody
    • IGDC1 antibody
    • IgSF1 antibody
    • IGSF1_HUMAN antibody
    • Immunoglobulin like domain containing protein 1 antibody
    • Immunoglobulin superfamily member 1 antibody
    • Immunoglobulin-like domain-containing protein 1 antibody
    • InhBP antibody
    • Inhibin binding protein antibody
    • Inhibin-binding protein antibody
    • KIAA0364 antibody
    • MGC75490 antibody
    • p120 antibody
    • PGSF2 antibody
    • Pituitary gland specific factor 2 antibody
    • Pituitary gland-specific factor 2 antibody
    see all

Images

  • Anti-IGSF1/p120 antibody (ab66509) at 1.25 µg/ml + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 148 kDa
    Observed band size: 27 kDa
    why is the actual band size different from the predicted?
    Additional bands at: 50 kDa. We are unsure as to the identity of these extra bands.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human kidney tissue labelling IGSF1/p120 with ab66509 at 4-8µg/ml. Arrows indicate positively labelled epithelial cells of the renal tubule. Magnification: 400X.

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab66509.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up