Overview

  • Product name

  • Description

    Rabbit polyclonal to IKAP/p150
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human IKAP/p150 aa 1107-1258.
    Sequence:

    TNVKPSILEAQKNYMAFLDSQTATFSRHKKRLLVVRELKEQAQQAGLDDE VPHGQESDLFSETSSVVSGSEMSGKYSHSNSRISARSSKNRRKAERKKHS LKEGSPLEDLALLEALSEVVQNTENLKDEVYHILKVLFLFEFDEQGRELQ KA


    Database link: O95163

  • Positive control

    • IHC-P: Human cervical cancer and kidney tissue. ICC/IF: HeLa cells.
  • General notes

     This product was previously labelled as IKAP

     

Properties

Applications

Our Abpromise guarantee covers the use of ab236740 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/200 - 1/500.
IHC-P 1/500 - 1/1000.

Target

  • Function

    May act as a scaffold protein that may assemble active IKK-MAP3K14 complexes (IKKA, IKKB and MAP3K14/NIK).
    Acts as subunit of the RNA polymerase II elongator complex, which is a histone acetyltransferase component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation. Elongator may play a role in chromatin remodeling and is involved in acetylation of histones H3 and probably H4.
  • Involvement in disease

    Defects in IKBKAP are the cause of hereditary sensory and autonomic neuropathy type 3 (HSAN3) [MIM:223900]; also known as Riley-Day syndrome or familial dysautonomia (FD). This autosomal recessive disorder is due to the poor development and survival, and progressive degeneration of the sensory, sympathetic and parasympathetic neurons. HSAN3 individuals are affected with a variety of symptoms such as decreased sensitivity to pain and temperature, cardiovascular instability, recurrent pneumonias, vomiting crises, and gastrointestinal dysfunction. It is primarily confined to individuals of Ashkenazi Jewish descent, with an incidence of 1/3'600 live births.
  • Sequence similarities

    Belongs to the ELP1/IKA1 family.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp781H1425 antibody
    • DYS antibody
    • Dysautonomia (Riley Day syndrome hereditary sensory autonomic neuropathy type III) antibody
    • Elongator complex protein 1 antibody
    • ELP 1 antibody
    • ELP1 antibody
    • ELP1_HUMAN antibody
    • FD antibody
    • FLJ12497 antibody
    • IKAP antibody
    • IkappaB kinase complex associated protein antibody
    • IkappaB kinase complex-associated protein antibody
    • ikbkap antibody
    • IKI 3 antibody
    • IKI3 antibody
    • IKK complex associated protein antibody
    • IKK complex-associated protein antibody
    • Inhibitor of kappa light polypeptide gene enhancer in B cells kinase complex associated protein antibody
    • OTTHUMP00000063889 antibody
    • p150 antibody
    • TOT 1 antibody
    • TOT1 antibody
    see all

Images

  • HeLa (Human epithelial cell line from cervix adenocarcinoma) cells stained for IKAP/p150 (green) using ab236740 at 1/200 dilution in ICC/IF. Secondary antibody is an Alexa-Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L). The nuclear counterstain is DAPI (blue).

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the antibody overnight at 4°C. 

  • Paraffin-embedded human cervical cancer tissue stained for IKAP/p150 using ab236740 at 1/600 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • Paraffin-embedded human kidney tissue stained for IKAP/p150 using ab236740 at 1/600 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

References

ab236740 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236740.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up