Overview

  • Product name

  • Description

    Rabbit polyclonal to IKB zeta
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant fragment corresponding to Human IKB zeta aa 454-586.
    Sequence:

    QGRRALSYVLARKMNALHMLDIKEHNGQSAFQVAVAANQHLIVQDLVNIG AQVNTTDCWGRTPLHVCAEKGHSQVLQAIQKGAVGSNQFVDLEATNYDGL TPLHCAVIAHNAVVHELQRNQQPHSPEVQELLL


    Database link: Q9BYH8

  • Positive control

    • IHC-P: Human bone marrow tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab246894 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Involved in regulation of NF-kappa-B transcription factor complexes. Inhibits NF-kappa-B activity without affecting its nuclear translocation upon stimulation. Inhibits DNA-binding of RELA and NFKB1/p50, and of the NF-kappa-B p65-p50 heterodimer and the NF-kappa-B p50-p50 homodimer. Seems also to activate NF-kappa-B-mediated transcription. In vitro, upon association with NFKB1/p50 has transcriptional activation activity and, together with NFKB1/p50 and RELA, is recruited to LCN2 promoters. Promotes transcription of LCN2 and DEFB4. Is recruited to IL-6 promoters and activates IL-6 but decreases TNF-alpha production in response to LPS. Seems to be involved in the induction of inflammatory genes activated through TLR/IL-1 receptor signaling. May promote apoptosis.
  • Tissue specificity

    Expressed at high levels in peripheral blood leukocytes and lung, at moderate levels in liver, placenta, and at low levels in spleen, kidney, skeletal muscle and heart.
  • Sequence similarities

    Contains 7 ANK repeats.
  • Cellular localization

    Nucleus. Aggregated in dot-like structures. Colocalizes with NCOR2.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ30225 antibody
    • FLJ34463 antibody
    • I-kappa-B-zeta antibody
    • Ikappa B zeta antibody
    • IkappaB zeta antibody
    • IkappaBzeta antibody
    • IkB-zeta antibody
    • IKBZ antibody
    • IKBZ_HUMAN antibody
    • IKBzeta antibody
    • IL-1 inducible nuclear ankyrin-repeat protein antibody
    • INAP antibody
    • MAIL antibody
    • MAIL protein antibody
    • Molecule possessing ankyrin repeats induced by lipopolysaccharide antibody
    • NF-kappa-B inhibitor zeta antibody
    • NFKBIZ antibody
    • Nuclear factor of kappa light polypeptide gene enhancer in B cells inhibitor zeta antibody
    see all

Images

  • Paraffin-embedded human cerebral cortex tissue stained for IKB zeta using ab246894 at 1/50 dilution in immunohistochemical analysis.
  • Paraffin-embedded human bone marrow tissue stained for IKB zeta using ab246894 at 1/50 dilution in immunohistochemical analysis.

References

ab246894 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246894.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up