Anti-IKIP antibody (ab221171)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-IKIP antibody
See all IKIP primary antibodies -
Description
Rabbit polyclonal to IKIP -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Human IKIP aa 280-359.
Sequence:IHSVLRVSQDLIETEKKMEDLTMQMFNMEDDMLKAVSEIMEMQKTLEGIQ YDNSILKMQNELDILKEKVHDFIAYSSTGE
Database link: Q70UQ0-4 -
Positive control
- ICC/IF: BJ cells. WB: RT-4 cell lysate.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab221171 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/1000. Detects a band of approximately 43 kDa (predicted molecular weight: 39 kDa). 43 kDa corresponds to isoform 4. |
|
ICC/IF | Use a concentration of 1 - 4 µg/ml. Recommended conditions:
Fixation/Permeabilization: PFA/Triton X-100 |
Target
-
Relevance
IKIP (I kappa B kinase interacting protein)is located on chromosome 12 in close proximity to APAF1 (apoptotic protease-activating factor-1). IKIP was originally cloned from a yeast two hybrid screening as an IKK2 interacting protein. IKIP and APAF1 share a common 488 bp promoter from which the two genes are transcribed in opposite directions, presumably in a co-regulated manner. Three IKIP transcripts are generated by differential splicing and alternative exon usage and show no significant homology to other genes. IKIP is expressed predominantly in the lung, kidney, spleen, thymus and skeletal muscle. Like APAF1, expression of IKIP is enhanced by ?-irradiation, in a p53-dependent manner. When transfected into endothelial cells IKIP promotes apoptosis suggesting that it plays a role in the cell death process as well as NF-?B regulation. -
Database links
- Entrez Gene: 121457 Human
- Entrez Gene: 67454 Mouse
- Entrez Gene: 314730 Rat
- Omim: 609861 Human
- SwissProt: Q70UQ0 Human
- SwissProt: Q9DBZ1 Mouse
- SwissProt: Q5EAJ6 Rat
- Unigene: 252543 Human
-
Alternative names
- FLJ31051 antibody
- I kappa B kinase interacting protein antibody
- IKBIP antibody
see all
Images
-
Immunofluorescent analysis of PFA fixed, triton X-100 permeabilized BJ cells labeling IKIP using ab221171 at 4 μg/mL (green).
-
Anti-IKIP antibody (ab221171) at 1/500 dilution + RT-4 cell lysate
Predicted band size: 39 kDa
Datasheets and documents
References
ab221171 has not yet been referenced specifically in any publications.