Anti-IKIP antibody (ab221171)
Key features and details
- Rabbit polyclonal to IKIP
- Suitable for: WB, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-IKIP antibody
See all IKIP primary antibodies -
Description
Rabbit polyclonal to IKIP -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat
-
Immunogen
Recombinant fragment corresponding to Human IKIP aa 280-359.
Sequence:IHSVLRVSQDLIETEKKMEDLTMQMFNMEDDMLKAVSEIMEMQKTLEGIQ YDNSILKMQNELDILKEKVHDFIAYSSTGE
Database link: Q70UQ0-4 -
Positive control
- ICC/IF: BJ cells. WB: RT-4 cell lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab221171 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.04 - 0.4 µg/ml. Detects a band of approximately 43 kDa (predicted molecular weight: 39 kDa). | |
| ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Relevance
IKIP (I kappa B kinase interacting protein)is located on chromosome 12 in close proximity to APAF1 (apoptotic protease-activating factor-1). IKIP was originally cloned from a yeast two hybrid screening as an IKK2 interacting protein. IKIP and APAF1 share a common 488 bp promoter from which the two genes are transcribed in opposite directions, presumably in a co-regulated manner. Three IKIP transcripts are generated by differential splicing and alternative exon usage and show no significant homology to other genes. IKIP is expressed predominantly in the lung, kidney, spleen, thymus and skeletal muscle. Like APAF1, expression of IKIP is enhanced by ?-irradiation, in a p53-dependent manner. When transfected into endothelial cells IKIP promotes apoptosis suggesting that it plays a role in the cell death process as well as NF-?B regulation. -
Database links
- Entrez Gene: 121457 Human
- Entrez Gene: 67454 Mouse
- Entrez Gene: 314730 Rat
- Omim: 609861 Human
- SwissProt: Q70UQ0 Human
- SwissProt: Q9DBZ1 Mouse
- SwissProt: Q5EAJ6 Rat
- Unigene: 252543 Human
-
Alternative names
- FLJ31051 antibody
- I kappa B kinase interacting protein antibody
- IKBIP antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-IKIP antibody (ab221171)Immunofluorescent analysis of PFA fixed, triton X-100 permeabilized BJ cells labeling IKIP using ab221171 at 4 μg/mL (green).
-
Western blot - Anti-IKIP antibody (ab221171)Anti-IKIP antibody (ab221171) at 1/500 dilution + RT-4 cell lysate
Predicted band size: 39 kDa
Protocols
Datasheets and documents
References (0)
ab221171 has not yet been referenced specifically in any publications.
