Overview

  • Product name

  • Description

    Rabbit polyclonal to IKIP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human IKIP aa 280-359.
    Sequence:

    IHSVLRVSQDLIETEKKMEDLTMQMFNMEDDMLKAVSEIMEMQKTLEGIQ YDNSILKMQNELDILKEKVHDFIAYSSTGE


    Database link: Q70UQ0-4

  • Positive control

    • ICC/IF: BJ cells. WB: RT-4 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab221171 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Detects a band of approximately 43 kDa (predicted molecular weight: 39 kDa).

43 kDa corresponds to isoform 4.

ICC/IF Use a concentration of 1 - 4 µg/ml.
Recommended conditions:
Fixation/Permeabilization: PFA/Triton X-100

Target

  • Relevance

    IKIP (I kappa B kinase interacting protein)is located on chromosome 12 in close proximity to APAF1 (apoptotic protease-activating factor-1). IKIP was originally cloned from a yeast two hybrid screening as an IKK2 interacting protein. IKIP and APAF1 share a common 488 bp promoter from which the two genes are transcribed in opposite directions, presumably in a co-regulated manner. Three IKIP transcripts are generated by differential splicing and alternative exon usage and show no significant homology to other genes. IKIP is expressed predominantly in the lung, kidney, spleen, thymus and skeletal muscle. Like APAF1, expression of IKIP is enhanced by ?-irradiation, in a p53-dependent manner. When transfected into endothelial cells IKIP promotes apoptosis suggesting that it plays a role in the cell death process as well as NF-?B regulation.
  • Database links

  • Alternative names

    • FLJ31051 antibody
    • I kappa B kinase interacting protein antibody
    • IKBIP antibody
    • IKBKB interacting protein antibody
    • IKIP1 antibody
    • IKIP2 antibody
    • IKIP3 antibody
    • IKK interacting protein antibody
    • Inhibitor of nuclear factor kappa B kinase interacting protein antibody
    see all

Images

  • Immunofluorescent analysis of PFA fixed, triton X-100 permeabilized BJ cells labeling IKIP using ab221171 at 4 μg/mL (green).

  • Anti-IKIP antibody (ab221171) at 1/500 dilution + RT-4 cell lysate

    Predicted band size: 39 kDa

References

ab221171 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221171.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up