Anti-IKKi/IKKe antibody [ABM13C7] - N-terminal (ab210927)

Overview

  • Product name
    Anti-IKKi/IKKe antibody [ABM13C7] - N-terminal
    See all IKKi/IKKe primary antibodies
  • Description
    Mouse monoclonal [ABM13C7] to IKKi/IKKe - N-terminal
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human IKKi/IKKe aa 2-203 (N terminal).
    Sequence:

    QSTANYLWHTDDLLGQGATASVYKARNKKSGELVAVKVFNTTSYLRPREV QVREFEVLRKLNHQNIVKLFAVEETGGSRQKVLVMEYCSSGSLLSVLESP ENAFGLPEDEFLVVLRCVVAGMNHLRENGIVHRDIKPGNIMRLVGEEGQS IYKLTDFGAARELDDDEKFVSVYGTEEYLHPDMYERAVLRKPQQKAFGVT VD


    Database link: Q14164

  • Positive control
    • Jurkat, HepG2 and mouse NIH 3T3 cell lysates; Human thyroid cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab210927 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2 µg/ml. Predicted molecular weight: 80 kDa.
IHC-P Use a concentration of 10 µg/ml.

Target

  • Function
    Phosphorylates inhibitors of NF-kappa-B thus leading to the dissociation of the inhibitor/NF-kappa-B complex and ultimately the degradation of the inhibitor. May play a special role in the immune response. Protects cells against DNA damage-induced cell death.
  • Tissue specificity
    Highly expressed in spleen followed by thymus, peripheral blood leukocytes, pancreas, placenta. Weakly expressed in lung, kidney, prostate, ovary and colon.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. I-kappa-B kinase subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Autophosphorylated.
    Sumoylation by TOPORS upon DNA damage is required for protection of cells against DNA damage-induced cell death. Desumoylated by SENP1.
  • Cellular localization
    Cytoplasm. Nucleus. Nucleus > PML body. Targeting to PML nuclear bodies upon DNA damage is TOPORS-dependent.
  • Information by UniProt
  • Database links
  • Alternative names
    • I kappa B kinase epsilon antibody
    • I-kappa-B kinase epsilon antibody
    • IkBKE antibody
    • IKK related kinase epsilon antibody
    • IKK-E antibody
    • IKK-epsilon antibody
    • IKK-i antibody
    • IKKE antibody
    • IKKE_HUMAN antibody
    • IKKepsilon antibody
    • IKKI antibody
    • Inducible I kappa B kinase antibody
    • Inducible I kappa-B kinase antibody
    • Inducible IkappaB kinase antibody
    • Inhibitor of kappa light polypeptide gene enhancer in B cells kinase epsilon antibody
    • Inhibitor of kappa light polypeptide gene enhancer in B cells, kinase of, epsilon antibody
    • Inhibitor of nuclear factor kappa-B kinase subunit epsilon antibody
    • KIAA0151 antibody
    • MGC125294 antibody
    • MGC125295 antibody
    • MGC125297 antibody
    see all

Images

  • All lanes : Anti-IKKi/IKKe antibody [ABM13C7] - N-terminal (ab210927) at 2 µg/ml

    Lane 1 : Jurkat cell lysate
    Lane 2 : mouse NIH 3T3 cell lysate
    Lane 3 : HepG2 cell lysate

    Predicted band size: 80 kDa

  • Immunohistochemical analysis of paraffin-embedded Human thyroid cancer tissue, labeling IKKi/IKKe with ab210927 at 10 μg/mL.

References

ab210927 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab210927.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up