Anti-IKZF3 antibody (ab134288)
Key features and details
- Rabbit polyclonal to IKZF3
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Get better batch-to-batch reproducibility with a recombinant antibody
- Research with confidence – consistent and reproducible results with every batch
- Long-term and scalable supply – powered by recombinant technology for fast production
- Success from the first experiment – confirmed specificity through extensive validation
- Ethical standards compliant – production is animal-free
Overview
-
Product name
Anti-IKZF3 antibody
See all IKZF3 primary antibodies -
Description
Rabbit polyclonal to IKZF3 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Chimpanzee, Monkey -
Immunogen
Synthetic peptide, corresponding to a region within the amino acids 350-400 (
EMSNGAPQELEKKSIHLPEKSVPSERGLSPNNSGHDSTDTDSNHEERQNH I
) of Human IKZF3. -
Positive control
- Human tonsil tissue
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store undiluted. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituents: 99% PBS, 0.05% BSA -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab134288 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P |
Use a concentration of 10 µg/ml.
|
Notes |
---|
IHC-P
Use a concentration of 10 µg/ml. |
Target
-
Function
Transcription factor that plays an important role in the regulation of lymphocyte differentiation. Plays an essential role in regulation of B-cell differentiation, proliferation and maturation to an effector state. Involved in regulating BCL2 expression and controlling apoptosis in T-cells in an IL2-dependent manner. -
Tissue specificity
Expressed most strongly in peripheral blood leukocytes, the spleen, and the thymus. -
Sequence similarities
Belongs to the Ikaros C2H2-type zinc-finger protein family.
Contains 6 C2H2-type zinc fingers. -
Post-translational
modificationsPhosphorylation on tyrosine residues induced by IL2 is required for dissociation from HRAS and nuclear translocation of IKZF3 in T-cells. Phosphorylation on tyrosine residues induced by IL4 is required for dissociation from Bcl-X(L) in T-cells. -
Cellular localization
Nucleus. Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 22806 Human
- Omim: 606221 Human
- SwissProt: Q9UKT9 Human
- Unigene: 444388 Human
-
Alternative names
- AIO antibody
- Aiolos antibody
- IKAROS family zinc finger 3 (Aiolos) antibody
see all
Images
Datasheets and documents
-
Datasheet download
References (0)
ab134288 has not yet been referenced specifically in any publications.