For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    il-1-alpha-antibody-ab9614.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Innate Immunity Macrophage / Inflamm.
Share by email

Anti-IL-1 alpha antibody (ab9614)

  • Datasheet
  • SDS
Reviews (3)Q&A (2)References (17)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IL-1 alpha antibody (ab9614)
  • Western blot - Anti-IL-1 alpha antibody (ab9614)
  • Sandwich ELISA - Anti-IL-1 alpha antibody (ab9614)

Key features and details

  • Rabbit polyclonal to IL-1 alpha
  • Suitable for: ICC/IF, Sandwich ELISA, WB, Neutralising, IHC-P, ELISA
  • Reacts with: Human
  • Isotype: unknown

Get better batch-to-batch reproducibility with a recombinant antibody

Product image
Anti-IL-1 alpha antibody [EPR19904-247] (ab206410)
  • Research with confidence – consistent and reproducible results with every batch
  • Long-term and scalable supply – powered by recombinant technology for fast production
  • Success from the first experiment – confirmed specificity through extensive validation
  • Ethical standards compliant – production is animal-free

Overview

  • Product name

    Anti-IL-1 alpha antibody
    See all IL-1 alpha primary antibodies
  • Description

    Rabbit polyclonal to IL-1 alpha
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, Sandwich ELISA, WB, Neutralising, IHC-P, ELISAmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human IL-1 alpha. Highly pure (>98%) recombinant hIL-1a (human Interleukin-1-alpha).
    Database link: P01583

  • Positive control

    • Purchase matching WB positive control:Recombinant human IL-1 alpha protein
    • IHC-P: Human liver tissue; Recombinant human IL-1 alpha protein (ab9615) can be used as a positive control in WB.
  • General notes

    This product is no longer batch tested in IHC, for an IHC validated antibody please see ab7632

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

  • Form

    Lyophilized:Reconstitute with 200µl of sterile water. The reconstituted antibody is stable for at least 2 weeks at 2-8C and at least 6 months at -20C
  • Storage instructions

    Shipped at 4°C. Store at -20ºC.
  • Storage buffer

    No preservative, sterile filtered
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    unknown
  • Light chain type

    unknown
  • Research areas

    • Immunology
    • Innate Immunity
    • Macrophage / Inflamm.
    • Immunology
    • Innate Immunity
    • Cytokines
    • Interleukins
    • Immunology
    • Secreted Molecules
    • Other secreted molecules
    • Metabolism
    • Types of disease
    • Obesity
    • Neuroscience
    • Processes

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Positive Controls

    • Recombinant human IL-1 alpha protein (ab9615)
  • Recombinant Protein

    • Recombinant human IL-1 alpha protein (ab9615)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab9614 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF (1)
Use at an assay dependent concentration.
Sandwich ELISA
Use at an assay dependent concentration.

To detect IL-1 αlpha by sandwich ELISA (using 100 μl/well antibody solution) a concentration of 0.5 - 2.0 μg/ml of this antibody is required. This antigen affinity purified antibody, in conjunction with ab271226 as a detection antibody, allows the detection of at least 0.2 - 0.4 ng/well of recombinant IL-1 αlpha.

WB (1)
Use at an assay dependent concentration. To detect hIL-1a by Western Blot analysis this antibody can be used at a concentration of 0.1 - 0.2 µg/ml. Used in conjunction with compatible secondary reagents the detection limit for recombinant hIL-1a is 1.5 - 3.0 ng/lane, under either reducing or non-reducing conditions.
Neutralising
Use at an assay dependent concentration.

To yield one-half maximal inhibition [ND50] of the biological activity of hIL-1a (20 ng/ml), a concentration of 1.0 - 2.0 µg/ml of this antibody is required.

IHC-P
Use a concentration of 1 µg/ml. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
ELISA
Use at an assay dependent concentration.

To detect hIL-1a by direct ELISA (using 100 µl/well antibody solution) a concentration of at least 0.5 µg/ml of this antibody is required. This antigen affinity purified antibody, in conjunction with compatible secondary reagents, allows the detection of 0.2 - 0.4 ng/well of recombinant hIL-1a.

Notes
ICC/IF
Use at an assay dependent concentration.
Sandwich ELISA
Use at an assay dependent concentration.

To detect IL-1 αlpha by sandwich ELISA (using 100 μl/well antibody solution) a concentration of 0.5 - 2.0 μg/ml of this antibody is required. This antigen affinity purified antibody, in conjunction with ab271226 as a detection antibody, allows the detection of at least 0.2 - 0.4 ng/well of recombinant IL-1 αlpha.

WB
Use at an assay dependent concentration. To detect hIL-1a by Western Blot analysis this antibody can be used at a concentration of 0.1 - 0.2 µg/ml. Used in conjunction with compatible secondary reagents the detection limit for recombinant hIL-1a is 1.5 - 3.0 ng/lane, under either reducing or non-reducing conditions.
Neutralising
Use at an assay dependent concentration.

To yield one-half maximal inhibition [ND50] of the biological activity of hIL-1a (20 ng/ml), a concentration of 1.0 - 2.0 µg/ml of this antibody is required.

IHC-P
Use a concentration of 1 µg/ml. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
ELISA
Use at an assay dependent concentration.

To detect hIL-1a by direct ELISA (using 100 µl/well antibody solution) a concentration of at least 0.5 µg/ml of this antibody is required. This antigen affinity purified antibody, in conjunction with compatible secondary reagents, allows the detection of 0.2 - 0.4 ng/well of recombinant hIL-1a.

Target

  • Function

    Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
  • Sequence similarities

    Belongs to the IL-1 family.
  • Domain

    The similarity among the IL-1 precursors suggests that the amino ends of these proteins serve some as yet undefined function.
  • Cellular localization

    Secreted. The lack of a specific hydrophobic segment in the precursor sequence suggests that IL-1 is released by damaged cells or is secreted by a mechanism differing from that used for other secretory proteins.
  • Target information above from: UniProt accession P01583 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 3552 Human
    • Omim: 147760 Human
    • SwissProt: P01583 Human
    • Unigene: 1722 Human
    • Alternative names

      • BAF antibody
      • FAF antibody
      • Hematopoietin 1 antibody
      • Hematopoietin-1 antibody
      • IL 1 alpha antibody
      • IL 1A antibody
      • IL-1 alpha antibody
      • Il-1a antibody
      • IL1 ALPHA antibody
      • IL1 antibody
      • IL1A antibody
      • IL1A_HUMAN antibody
      • IL1F1 antibody
      • Interleukin 1 alpha antibody
      • Interleukin-1 alpha antibody
      • Interleukin1 alpha antibody
      • LAF antibody
      • LEM antibody
      • Preinterleukin 1 alpha antibody
      • Pro interleukin 1 alpha antibody
      see all

    Images

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IL-1 alpha antibody (ab9614)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IL-1 alpha antibody (ab9614)

      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human liver tissue labelling IL-1 alpha with ab9614 at 1 µg/mL (45 minute incubation at room temperature). Heat mediated antigen retrieval was performed using a buffer at pH 6. An HRP-labeled polymer detection system was used with a DAB chromogen.

    • Western blot - Anti-IL-1 alpha antibody (ab9614)
      Western blot - Anti-IL-1 alpha antibody (ab9614)
    • Sandwich ELISA - Anti-IL-1 alpha antibody (ab9614)
      Sandwich ELISA - Anti-IL-1 alpha antibody (ab9614)

    Protocols

    • Immunocytochemistry & immunofluorescence protocols
    • Western blot protocols

    Click here to view the general protocols

    Datasheets and documents

    • SDS download

    • Datasheet download

      Download

    References (17)

    Publishing research using ab9614? Please let us know so that we can cite the reference in this datasheet.

    ab9614 has been referenced in 17 publications.

    • Tanaka Y  et al. Baicalein Inhibits Benzo[a]pyrene-Induced Toxic Response by Downregulating Src Phosphorylation and by Upregulating NRF2-HMOX1 System. Antioxidants (Basel) 9:N/A (2020). PubMed: 32526964
    • Guttenplan KA  et al. Neurotoxic Reactive Astrocytes Drive Neuronal Death after Retinal Injury. Cell Rep 31:107776 (2020). PubMed: 32579912
    • Moreno-Valladares M  et al. CD8+ T cells are increased in the subventricular zone with physiological and pathological aging. Aging Cell 19:e13198 (2020). PubMed: 32741087
    • Lau L  et al. Uncoupling the Senescence-Associated Secretory Phenotype from Cell Cycle Exit via Interleukin-1 Inactivation Unveils Its Protumorigenic Role. Mol Cell Biol 39:N/A (2019). PubMed: 30988157
    • Rajan A  et al. Impact of Nuclear Interleukin-1 Alpha and EGFR Expression on Recurrence and Survival Outcomes in Oral Squamous Cell Carcinomas. J Oncol 2019:5859680 (2019). PubMed: 31320902
    View all Publications for this product

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    1-5 of 5 Abreviews or Q&A

    Immunohistochemistry (Frozen sections) abreview for Anti-IL-1 alpha antibody

    Average
    Abreviews
    Abreviews
    abreview image
    Application
    Immunohistochemistry (Frozen sections)
    Sample
    Mouse Tissue sections (pulp injury)
    Permeabilization
    Yes - Triton
    Specification
    pulp injury
    Blocking step
    Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C
    Fixative
    Paraformaldehyde
    Read More

    DR. Tina Yuan

    Verified customer

    Submitted Jan 25 2018

    Western blot abreview for Anti-IL-1 alpha antibody

    Good
    Abreviews
    Abreviews
    abreview image
    Application
    Western blot
    Sample
    Human Cell lysate - whole cell (SCC12F - human oro-facial keratinocyte)
    Gel Running Conditions
    Reduced Denaturing (15%)
    Loading amount
    30 µg
    Specification
    SCC12F - human oro-facial keratinocyte
    Blocking step
    Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 23°C
    Read More

    Dr. Mhairi Morris

    Verified customer

    Submitted Jan 28 2010

    Immunocytochemistry/ Immunofluorescence abreview for Anti-IL-1 alpha antibody

    Excellent
    Abreviews
    Abreviews
    abreview image
    Application
    Immunocytochemistry/ Immunofluorescence
    Sample
    Human Cell (Human primary tonsillar epithelial cell)
    Permeabilization
    Yes - 0.5% Triton X-100
    Specification
    Human primary tonsillar epithelial cell
    Blocking step
    Serum as blocking agent for 15 minute(s) · Concentration: 20% · Temperature: 23°C
    Fixative
    Paraformaldehyde
    Read More

    Dr. Mhairi Morris

    Verified customer

    Submitted Sep 09 2009

    Question

    I would like to use this Ab: Anti-IL1 alpha antibody (ab9614) for immunocytochemistry. I have this negative control which I have purcahsed from Dako - Negative Control, Rabbit Immunoglobulin Fraction (Solid-Phase Absorbed) X0936. I have used this negative control for my previous antibody anti-HMGB1 antibody - ChIP Grade (ab18256).

    I am just wondered, can I use the same negative control for ab9614? if not, can you please advise the appropriate negative control for ab9614?

    Read More

    Abcam community

    Verified customer

    Asked on Sep 10 2012

    Answer

    Thank you for contacting us.

    As shown on the product datasheets, ab9614 and ab18256 are bothpolyclonal antibodies. The same negative control should therefore besuitable for both products.

    I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

    Read More

    Abcam Scientific Support

    Answered on Sep 10 2012

    Question

    Can you please specify exactly the immunogen this antibody was raised against? Mature or precursor IL-1 alpha, aa numbers if possible.

    Read More

    Abcam community

    Verified customer

    Asked on Apr 26 2002

    Answer

    The human IL-1 peptide sequence used to raise this antibody is: SAPFSFLSNVKYNFMRIIKYEFILNDALNQ SIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA (159 amino acid residues, 18.0 kDa)

    Read More

    Simon Renshaw

    Abcam Scientific Support

    Answered on Apr 29 2002

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2022 Abcam plc. All rights reserved.