Overview

  • Product name

    Anti-IL-1 alpha antibody [C1]
    See all IL-1 alpha primary antibodies
  • Description

    Mouse monoclonal [C1] to IL-1 alpha
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human IL-1 alpha aa 113-271. Two N-terminal tags, His and T7. Expressed in E. coli. Full length mature chain without propeptide.
    Sequence:

    SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDE AVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPK TITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSIT DFQILENQA


    Database link: Q53QF9

  • Positive control

    • IHC-P: Human kidney, prostate, stomach cancer and stomach tissue. WB: Recombinant human IL-1 alpha protein. Rat liver lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab239517 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml.

Target

  • Function

    Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
  • Sequence similarities

    Belongs to the IL-1 family.
  • Domain

    The similarity among the IL-1 precursors suggests that the amino ends of these proteins serve some as yet undefined function.
  • Cellular localization

    Secreted. The lack of a specific hydrophobic segment in the precursor sequence suggests that IL-1 is released by damaged cells or is secreted by a mechanism differing from that used for other secretory proteins.
  • Information by UniProt
  • Database links

  • Alternative names

    • BAF antibody
    • FAF antibody
    • Hematopoietin 1 antibody
    • Hematopoietin-1 antibody
    • IL 1 alpha antibody
    • IL 1A antibody
    • IL-1 alpha antibody
    • Il-1a antibody
    • IL1 ALPHA antibody
    • IL1 antibody
    • IL1A antibody
    • IL1A_HUMAN antibody
    • IL1F1 antibody
    • Interleukin 1 alpha antibody
    • Interleukin-1 alpha antibody
    • Interleukin1 alpha antibody
    • LAF antibody
    • LEM antibody
    • Preinterleukin 1 alpha antibody
    • Pro interleukin 1 alpha antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for IL-1 alpha with ab239517 at 40 µg/ml in immunohistochemical analysis. DAB staining. HRP-Goat Anti-Mouse IgG secondary antibody was used at 2 µg/ml.

  • Anti-IL-1 alpha antibody [C1] (ab239517) at 3 µg/ml + Rat liver tissue lysate

    Secondary
    HRP-Goat Anti-Mouse IgG at 0.2 µg/ml
  • Formalin-fixed, paraffin-embedded human stomach tissue stained for IL-1 alpha with ab239517 at 40 µg/ml in immunohistochemical analysis. DAB staining. HRP-Goat Anti-Mouse IgG secondary antibody was used at 2 µg/ml.

  • Formalin-fixed, paraffin-embedded human stomach cancer tissue stained for IL-1 alpha with ab239517 at 40 µg/ml in immunohistochemical analysis. DAB staining. HRP-Goat Anti-Mouse IgG secondary antibody was used at 2 µg/ml.

  • Formalin-fixed, paraffin-embedded human prostate tissue stained for IL-1 alpha with ab239517 at 40 µg/ml in immunohistochemical analysis. DAB staining. HRP-Goat Anti-Mouse IgG secondary antibody was used at 2 µg/ml.

  • Anti-IL-1 alpha antibody [C1] (ab239517) at 2 µg/ml + Recombinant human IL-1 alpha protein

References

ab239517 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239517.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up