Overview

  • Product name

    Anti-IL-1 beta antibody [OTI3E1]
    See all IL-1 beta primary antibodies
  • Description

    Mouse monoclonal [OTI3E1] to IL-1 beta
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human IL-1 beta aa 1-269. NP_000567, produced in HEK293T cells
    Sequence:

    MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQL RISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEE EPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQ DMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLES VDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFL GGTKGGQDITDFTMQFVSS

  • Positive control

    • Recombinant human IL-1 beta protein (ab9617) can be used as a positive control in WB. HEK293T cells or Cos7 transfected with pCMV6-ENTRY IL1B cDNA; Human endometrium adenocarcinoma tissue.
  • General notes

    The clone number has been updated from 3E1 to OTI3E1, both clone numbers name the same clone.

    This product was changed from ascites to tissue culture supernatant on 6th September 2018. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.

Properties

Applications

Our Abpromise guarantee covers the use of ab156791 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/4000. Predicted molecular weight: 31 kDa.
IHC-P 1/150.
ICC/IF 1/100.

Target

  • Function

    Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. Promotes Th17 differentiation of T-cells.
  • Tissue specificity

    Expressed in activated monocytes/macrophages (at protein level).
  • Sequence similarities

    Belongs to the IL-1 family.
  • Post-translational
    modifications

    Activation of the IL1B precursor involves a CASP1-catalyzed proteolytic cleavage. Processing and secretion are temporarily associated.
  • Cellular localization

    Cytoplasm, cytosol. Lysosome. Secreted, exosome. Cytoplasmic vesicle, autophagosome. Secreted. The precursor is cytosolic. In response to inflammasome-activating signals, such as ATP for NLRP3 inflammasome or bacterial flagellin for NLRC4 inflammasome, cleaved and secreted. IL1B lacks any known signal sequence and the pathway(s) of its secretion is(are) not yet fully understood (PubMed:24201029). On the basis of experimental results, several unconventional secretion mechanisms have been proposed. 1. Secretion via secretory lysosomes: a fraction of CASP1 and IL1B precursor may be incorporated, by a yet undefined mechanism, into secretory lysosomes that undergo Ca(2+)-dependent exocytosis with release of mature IL1B (PubMed:15192144). 2. Secretory autophagy: IL1B-containing autophagosomes may fuse with endosomes or multivesicular bodies (MVBs) and then merge with the plasma membrane releasing soluble IL1B or IL1B-containing exosomes (PubMed:24201029). However, autophagy impacts IL1B production at several levels and its role in secretion is still controversial. 3. Secretion via exosomes: ATP-activation of P2RX7 leads to the formation of MVBs containing exosomes with entrapped IL1B, CASP1 and other inflammasome components. These MVBs undergo exocytosis with the release of exosomes. The release of soluble IL1B occurs after the lysis of exosome membranes (By similarity). 4. Secretion by microvesicle shedding: activation of the ATP receptor P2RX7 may induce an immediate shedding of membrane-derived microvesicles containing IL1B and possibly inflammasome components. The cytokine is then released in the extracellular compartment after microvesicle lysis (PubMed:11728343). 5. Release by translocation through permeabilized plasma membrane. This may occur in cells undergoing pyroptosis due to sustained activation of the inflammasome (By similarity). These mechanisms may not be not mutually exclusive.
  • Information by UniProt
  • Database links

  • Alternative names

    • Catabolin antibody
    • H1 antibody
    • IL 1 antibody
    • IL 1 beta antibody
    • IL-1 beta antibody
    • IL1 BETA antibody
    • IL1B antibody
    • IL1B_HUMAN antibody
    • IL1F2 antibody
    • Interleukin 1 beta antibody
    • Interleukin-1 beta antibody
    • OAF antibody
    • OTTHUMP00000162031 antibody
    • Preinterleukin 1 beta antibody
    • Pro interleukin 1 beta antibody
    see all

Images

  • All lanes : Anti-IL-1 beta antibody [OTI3E1] (ab156791) at 1/1000 dilution

    Lane 1 : HEK293T cells transfected with pCMV6-ENTRY control
    Lane 2 : HEK293T cells transfected with pCMV6-ENTRY IL1B

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 31 kDa



    HEK293T cell lysates were generated from transient transfection of the cDNA clone (RC213720)
  • Immunohistochemical staining of paraffin-embedded Human endometrium adenocarcinoma tissue labelleing IL-1B using ab156791 at 1/150 dilution.

  • Immunofluorescence analysis of COS7 cells transiently transfected with pCMV6-ENTRY IL-1B labeling IL-1B with ab156791 at 1/100 dilution.

References

This product has been referenced in:

  • Guo Q  et al. Cytokine Secretion and Pyroptosis of Thyroid Follicular Cells Mediated by Enhanced NLRP3, NLRP1, NLRC4, and AIM2 Inflammasomes Are Associated With Autoimmune Thyroiditis. Front Immunol 9:1197 (2018). Read more (PubMed: 29915579) »
  • Ma CT  et al. Fusobacterium nucleatum promotes the progression of colorectal cancer by interacting with E-cadherin. Oncol Lett 16:2606-2612 (2018). Read more (PubMed: 30013655) »
See all 3 Publications for this product

Customer reviews and Q&As

Answer

The full length recombinant Human IL1B (NP_000567) produced in HEK293T cells was used as an immunogen for this antibody and we haven't done any epitope mapping. It is raised against the purified pro-IL-1b protein, but we are not sure where on the protein the antibody react with. So it might react with both pro-IL-1b and mature IL-1b proteins.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up