Overview

  • Product name

  • Description

    Rabbit polyclonal to IL-10
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Human IL-10 aa 127-159 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    HRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMS


    Database link: P22301

  • Positive control

    • Human colon carcinoma and lung carcinoma tissues

Properties

Applications

Our Abpromise guarantee covers the use of ab217941 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function

    Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.
  • Tissue specificity

    Produced by a variety of cell lines, including T-cells, macrophages, mast cells and other cell types.
  • Sequence similarities

    Belongs to the IL-10 family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • CSIF antibody
    • Cytokine synthesis inhibitory factor antibody
    • GVHDS antibody
    • IL 10 antibody
    • IL-10 antibody
    • IL10 antibody
    • IL10_HUMAN antibody
    • IL10A antibody
    • Interleukin 10 antibody
    • Interleukin-10 antibody
    • MGC126450 antibody
    • MGC126451 antibody
    • T-cell growth inhibitory factor antibody
    • TGIF antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed and paraffin embedded Human colon carcinoma tissue labeling IL-10 using ab217941 at 1/200, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed and paraffin embedded Human lung carcinoma tissue labeling IL-10 using ab217941 at 1/200, followed by conjugation to the secondary antibody and DAB staining.

References

ab217941 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217941.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up