Overview

  • Product name

  • Description

    Rabbit polyclonal to IL-10RA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human IL-10RA aa 22-230.
    Sequence:

    HGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVALLRYGIESWNS ISNCSQTLSYDLTAVTLDLYHSNGYRARVRAVDGSRHSNWTVTNTRFSVD EVTLTVGSVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFREYEIAI RKVPGNFTFTHKKVKHENFSLLTSGEVGEFCVQVKPSVASRSNKGMWSKE ECISLTRQY


    Database link: Q13651

  • Positive control

    • WB: K562 and MCF7 cell extracts. Mouse brain extract. IHC-P: Rat and mouse brain tissue. ICC/IF: U-2 OS cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab225820 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Detects a band of approximately 72 kDa (predicted molecular weight: 63 kDa).
IHC 1/50 - 1/200.
ICC/IF 1/50 - 1/200.
IHC-P 1/50 - 1/200.

Target

  • Function

    Receptor for IL10; binds IL10 with a high affinity.
  • Tissue specificity

    Spleen, thymus, and PBMC. Weak expression in pancreas, skeletal muscle, brain, heart, and kidney. Placenta, lung, and liver showed intermediate levels. Monocytes, B-cells, large granular lymphocytes, and T-cells express high levels.
  • Involvement in disease

    Inflammatory bowel disease 28
  • Sequence similarities

    Belongs to the type II cytokine receptor family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD210 antibody
    • CDw210a antibody
    • CDw210a antigen antibody
    • HIL 10R antibody
    • HIL10R antibody
    • I10R1_HUMAN antibody
    • IL 10R 1 antibody
    • IL 10R A antibody
    • IL 10R antibody
    • IL 10R1 antibody
    • IL-10 receptor subunit alpha antibody
    • IL-10R subunit 1 antibody
    • IL-10R subunit alpha antibody
    • IL-10R1 antibody
    • IL-10RA antibody
    • IL10R antibody
    • IL10R1 antibody
    • IL10RA antibody
    • Interleukin 10 receptor alpha antibody
    • Interleukin 10 receptor alpha chain antibody
    • Interleukin-10 receptor subunit 1 antibody
    • Interleukin-10 receptor subunit alpha antibody
    see all

Images

  • All lanes : Anti-IL-10RA antibody (ab225820) at 1/1000 dilution

    Lane 1 : K562 (human chronic myelogenous leukemia cell line from bone marrow) extract
    Lane 2 : MCF7 (human breast adenocarcinoma cell line) extract
    Lane 3 : Mouse brain extract

    Lysates/proteins at 25 µg per lane.

    Secondary
    All lanes : HRP Goat Anti-Rabbit IgG (H+L) at 1/10000 dilution

    Developed using the ECL technique.

    Predicted band size: 63 kDa



    Blocking buffer: 3% non-fat dry milk in TBST.

  • U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for IL-10RA (green) using ab225820 at 1/50 dilution in ICC/IF. DAPI (blue) for nuclear staining.

  • Paraffin-embedded rat brain tissue stained for IL-10RA with ab225820 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded rat brain tissue stained for IL-10RA with ab225820 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded mouse brain tissue stained for IL-10RA with ab225820 at 1/100 dilution in immunohistochemical analysis.

References

ab225820 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225820.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up