Overview

  • Product name

    Anti-IL-13 receptor alpha 1 antibody
    See all IL-13 receptor alpha 1 primary antibodies
  • Description

    Rabbit polyclonal to IL-13 receptor alpha 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human IL-13 receptor alpha 1 aa 137-210. Expressed in E.coli.
    Sequence:

    HNLSYMKCSWLPGRNTSPDTNYTLYYWHRSLEKIHQCENIFREGQYFGCS FDLTKVKDSSFEQHSVQIMVKDNA


    Database link: P78552

  • Positive control

    • WB: Recombinant human IL-13 receptor alpha 1; Pig liver tissue lysate. IHC-P: Human testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab232890 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 49 kDa.

Target

  • Function

    Binds with low affinity to interleukin-13 (IL13). Together with IL4RA can form a functional receptor for IL13. Also serves as an alternate accessory protein to the common cytokine receptor gamma chain for interleukin-4 (IL4) signaling, but cannot replace the function of IL2RG in allowing enhanced interleukin-2 (IL2) binding activity.
  • Tissue specificity

    Ubiquitous. Highest levels in heart, liver, skeletal muscle and ovary; lowest levels in brain, lung and kidney. Also found in B-cells, T-cells and endothelial cells.
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 5 subfamily.
  • Domain

    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • bB128O4.2.1 (interleukin 13 receptor, alpha 1) antibody
    • Cancer/testis antigen 19 antibody
    • CD213a1 antibody
    • CD213A1 Antigen antibody
    • CT 19 antibody
    • CT19 antibody
    • I13R1_HUMAN antibody
    • IL 13 receptor subunit alpha 1 antibody
    • IL 13R alpha 1 antibody
    • IL 13R subunit alpha 1 antibody
    • IL 13Ra antibody
    • IL 13RA1 antibody
    • IL-13 receptor subunit alpha-1 antibody
    • IL-13R subunit alpha-1 antibody
    • IL-13R-alpha-1 antibody
    • IL-13RA1 antibody
    • IL13 receptor alpha 1 chain antibody
    • IL13R antibody
    • IL13RA antibody
    • Il13ra1 antibody
    • Interleukin 13 receptor alpha 1 antibody
    • Interleukin 13 receptor alpha 1 chain antibody
    • interleukin 13 receptor subunit alpha 1 antibody
    • Interleukin-13 receptor subunit alpha-1 antibody
    • NR 4 antibody
    • NR4 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human testis tissue stained for IL-13 receptor alpha 1 using ab232890 at 20μg/ml in immunohistochemical analysis.

  • Anti-IL-13 receptor alpha 1 antibody (ab232890) at 2 µg/ml + Recombinant human IL-13 receptor alpha 1 protein

    Developed using the ECL technique.

    Predicted band size: 49 kDa

  • Anti-IL-13 receptor alpha 1 antibody (ab232890) at 2 µg/ml + Pig liver tissue lysate

    Developed using the ECL technique.

    Predicted band size: 49 kDa

References

ab232890 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232890.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up