Overview

  • Product name

    Anti-IL-13 receptor alpha 2 antibody [2E10]
    See all IL-13 receptor alpha 2 primary antibodies
  • Description

    Mouse monoclonal [2E10] to IL-13 receptor alpha 2
  • Host species

    Mouse
  • Tested applications

    Suitable for: Flow Cyt, WB, IHC-P, ICC, IP, ICC/IF, IHC-Frmore details
  • Species reactivity

    Reacts with: Rabbit, Human
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human IL-13 receptor alpha 2 aa 27-126.
    Sequence:

    DTEIKVNPPQDFEIVDPGYLGYLYLQWQPPLSLDHFKECTVEYELKYRNI GSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQSSWAET


    Database link: Q14627

  • Positive control

  • General notes

    This product was changed from ascites to tissue culture supernatant on 13th Feb 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.

Properties

Applications

Our Abpromise guarantee covers the use of ab55275 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt Use at an assay dependent concentration.

ab170191 - Mouse monoclonal IgG2a, is suitable for use as an isotype control with this antibody.

 

WB Use at an assay dependent concentration. Predicted molecular weight: 44 kDa.
IHC-P Use at an assay dependent concentration.
ICC Use at an assay dependent concentration.
IP Use at an assay dependent concentration.
ICC/IF Use at an assay dependent concentration.
IHC-Fr Use at an assay dependent concentration.

Target

  • Function

    Binds as a monomer with high affinity to interleukin-13 (IL13), but not to interleukin-4 (IL4).
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 5 subfamily.
    Contains 1 fibronectin type-III domain.
  • Domain

    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cancer/testis antigen 19 antibody
    • CD213a2 antibody
    • CT19 antibody
    • I13R2_HUMAN antibody
    • IL-13 receptor subunit alpha-2 antibody
    • IL-13R subunit alpha-2 antibody
    • IL-13R-alpha-2 antibody
    • IL-13RA2 antibody
    • IL13 receptor antibody
    • IL13BP antibody
    • IL13R antibody
    • Il13ra2 antibody
    • Interleukin 13 binding protein antibody
    • Interleukin 13 receptor alpha 2 chain antibody
    • Interleukin-13 receptor subunit alpha-2 antibody
    • Interleukin-13-binding protein antibody
    see all

Images

  • Overlay histogram showing HeLa cells stained with ab55275 (red line). The cells were fixed with methanol (5 min) and incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab55275, 0.5µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG2a [ICIGG2A] (ab91361, 1µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in HeLa cells fixed with 4% paraformaldehyde (10 min) used under the same conditions.

    Please note that Abcam do not have data for use of this antibody on non-fixed cells. We welcome any customer feedback.

    This image was generated using the ascites version of the product.

  • ab55275 staining IL-13 rexeptor alpha 2 in Rabbit ear wound exudate tissue sections by Immunohistochemistry (IHC-P - paraformaldehyde-fixed, paraffin-embedded sections). Tissue was fixed with formaldehyde and blocked with 100% Protein block (serum free) for 30 minutes at 37°C; antigen retrieval was enzymatic. Samples were incubated with primary antibody (1µg/ml) for 1 hour at 37°C. An undiluted HRP-conjugated Mouse anti-mouse IgG polyclonal was used as the secondary antibody.

    This image was generated using the ascites version of the product.

    See Abreview

  • IL-13 receptor alpha 2 antibody (ab55275) used in immunohistochemistry at 1ug/ml on formalin fixed and paraffin embedded human stomach.

    This image was generated using the ascites version of the product.

  • IL-13 receptor alpha 2 antibody (ab55275) at 1ug/ml + HeLa cell lysate at 25ug/lane.

    This image was generated using the ascites version of the product.

  • All lanes : Anti-IL-13 receptor alpha 2 antibody [2E10] (ab55275)

    Lane 1 : Non-transfected HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : HEK-293 (human epithelial cell line from embryonic kidney) transfected with IL-13 receptor alpha 2 chimera RNAi, cell lysate

    Predicted band size: 44 kDa



    This image was generated using the ascites version of the product.

  • All lanes : Anti-IL-13 receptor alpha 2 antibody [2E10] (ab55275)

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with IL-13 receptor alpha 2, cell lysate
    Lane 2 : Non-transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Predicted band size: 44 kDa



    This image was generated using the ascites version of the product.

References

This product has been referenced in:

See all 7 Publications for this product

Customer reviews and Q&As

1-8 of 8 Abreviews or Q&A

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Rabbit Tissue sections (Ear wound exudates)
Antigen retrieval step
Enzymatic
Permeabilization
No
Specification
Ear wound exudates
Blocking step
(agent) for 30 minute(s) · Concentration: 100% · Temperature: 37°C
Fixative
Formaldehyde

Dr. Harshini Sarojini

Verified customer

Submitted Oct 02 2013

Answer

Thank you for contacting us.
The molecular weight of Anti-IL13 receptor alpha 2 antibody (ab55275) is around 150KDa.
I hope this helps and if we can assist further, please do not hesitate to contact us.

Read More
Application
Immunoprecipitation
Sample
Human Cell lysate - whole cell (AGS Gastric Carcinoma cells)
Total protein in input
200 µg
Immuno-precipitation step
Protein A/G
Specification
AGS Gastric Carcinoma cells

Abcam user community

Verified customer

Submitted Jun 03 2010

Application
Immunohistochemistry (Frozen sections)
Sample
Human Tissue sections (Stomach)
Permeabilization
No
Specification
Stomach
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 23°C
Fixative
Acetone

Abcam user community

Verified customer

Submitted May 26 2010

Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (AGS Gastric Carcinoma Cells)
Permeabilization
Yes - 0.025% Triton-X in TBS
Specification
AGS Gastric Carcinoma Cells
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 23°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted May 26 2010

Application
Immunocytochemistry
Sample
Human Cultured Cells (AGS Gastric Carcinoma cells)
Permeabilization
Yes - 0.025% Triton-X in TBS
Specification
AGS Gastric Carcinoma cells
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 23°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Apr 09 2010

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (Stomach)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Citrate pH 6.0
Permeabilization
No
Specification
Stomach
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 23°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Sep 23 2009

Application
Western blot
Sample
Human Cell lysate - whole cell (AGS)
Gel Running Conditions
Reduced Denaturing
Loading amount
10 µg
Specification
AGS
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 23°C

Abcam user community

Verified customer

Submitted Sep 23 2009

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up