Anti-IL-17A antibody (ab214588)
Key features and details
- Rabbit polyclonal to IL-17A
- Suitable for: IHC-P
- Reacts with: Rat
- Isotype: IgG
Overview
-
Product name
Anti-IL-17A antibody
See all IL-17A primary antibodies -
Description
Rabbit polyclonal to IL-17A -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Rat
Predicted to work with: Mouse
-
Immunogen
Synthetic peptide within Rat IL-17A aa 110-150 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
Sequence:IQQEILVLKREPEKCPFTFRVEKMLVGVGCTCVSSIVRHAS
Database link: Q61453 -
Positive control
- Rat tongue and stomach tissues.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 50% Glycerol, 1% BSA -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab214588 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/100 - 1/600. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Induces stromal cells to produce proinflammatory and hematopoietic cytokines. Enhances the surface expression of the intracellular adhesion molecule-1 (ICAM-1) in fibroblasts. -
Tissue specificity
Restricted to activated memory T-cells. -
Sequence similarities
Belongs to the IL-17 family. -
Post-translational
modificationsFound both in glycosylated and nonglycosylated forms. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 16171 Mouse
- Entrez Gene: 301289 Rat
- SwissProt: Q62386 Mouse
- SwissProt: Q61453 Rat
-
Alternative names
- CTLA 8 antibody
- CTLA-8 antibody
- CTLA8 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IL-17A antibody (ab214588)Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat tongue tissue labeling IL-17A with ab214588 at 1/600 dilution, followed by secondary antibody detection and DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IL-17A antibody (ab214588)Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat stomach tissue labeling IL-17A with ab214588 at 1/600 dilution, followed by secondary antibody detection and DAB staining.
References
ab214588 has been referenced in 2 publications.
- Chen A et al. Inhibition of miR-155-5p attenuates the valvular damage induced by rheumatic heart disease. Int J Mol Med 45:429-440 (2020). PubMed: 31894293
- Bi CS et al. Calcitriol suppresses lipopolysaccharide-induced alveolar bone damage in rats by regulating T helper cell subset polarization. J Periodontal Res 54:612-623 (2019). PubMed: 31095745
