Overview

  • Product name

  • Description

    Rabbit polyclonal to IL-17A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide within Rat IL-17A aa 110-150 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    IQQEILVLKREPEKCPFTFRVEKMLVGVGCTCVSSIVRHAS


    Database link: Q61453

  • Positive control

    • Rat tongue and stomach tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 50% Glycerol, 1% BSA
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab214588 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/600. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Induces stromal cells to produce proinflammatory and hematopoietic cytokines. Enhances the surface expression of the intracellular adhesion molecule-1 (ICAM-1) in fibroblasts.
  • Tissue specificity

    Restricted to activated memory T-cells.
  • Sequence similarities

    Belongs to the IL-17 family.
  • Post-translational
    modifications

    Found both in glycosylated and nonglycosylated forms.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • CTLA 8 antibody
    • CTLA-8 antibody
    • CTLA8 antibody
    • cytotoxic T lymphocyte associated antigen 8 antibody
    • Cytotoxic T lymphocyte associated protein 8 antibody
    • Cytotoxic T lymphocyte associated serine esterase 8 antibody
    • Cytotoxic T-lymphocyte-associated antigen 8 antibody
    • IL 17 antibody
    • IL 17A antibody
    • IL-17 antibody
    • IL-17A antibody
    • IL17 antibody
    • IL17_HUMAN antibody
    • Il17a antibody
    • Interleukin 17 (cytotoxic T lymphocyte associated serine esterase 8) antibody
    • interleukin 17A antibody
    • Interleukin-17A antibody
    • interleukin17 antibody
    • Interleukin17A antibody
    • OTTHUMP00000016597 antibody
    • OTTMUSP00000046003 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat tongue tissue labeling IL-17A with ab214588 at 1/600 dilution, followed by secondary antibody detection and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat stomach tissue labeling IL-17A with ab214588 at 1/600 dilution, followed by secondary antibody detection and DAB staining.

References

ab214588 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214588.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up