Overview

  • Product name

  • Description

    Rabbit polyclonal to IL-17A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
    Unsuitable for: ICC
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human IL-17A aa 40-80 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    NFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNE


    Database link: Q16552

  • Positive control

    • Human oral squamous cell carcinoma tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab217359 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/1000.
  • Application notes
    Is unsuitable for ICC.
  • Target

    • Function

      Induces stromal cells to produce proinflammatory and hematopoietic cytokines. Enhances the surface expression of the intracellular adhesion molecule-1 (ICAM-1) in fibroblasts.
    • Tissue specificity

      Restricted to activated memory T-cells.
    • Sequence similarities

      Belongs to the IL-17 family.
    • Post-translational
      modifications

      Found both in glycosylated and nonglycosylated forms.
    • Cellular localization

      Secreted.
    • Information by UniProt
    • Database links

    • Alternative names

      • CTLA 8 antibody
      • CTLA-8 antibody
      • CTLA8 antibody
      • cytotoxic T lymphocyte associated antigen 8 antibody
      • Cytotoxic T lymphocyte associated protein 8 antibody
      • Cytotoxic T lymphocyte associated serine esterase 8 antibody
      • Cytotoxic T-lymphocyte-associated antigen 8 antibody
      • IL 17 antibody
      • IL 17A antibody
      • IL-17 antibody
      • IL-17A antibody
      • IL17 antibody
      • IL17_HUMAN antibody
      • Il17a antibody
      • Interleukin 17 (cytotoxic T lymphocyte associated serine esterase 8) antibody
      • interleukin 17A antibody
      • Interleukin-17A antibody
      • interleukin17 antibody
      • Interleukin17A antibody
      • OTTHUMP00000016597 antibody
      • OTTMUSP00000046003 antibody
      see all

    Images

    • Anti-IL-17A antibody (ab217359) at 1/1000 dilution + Raji cell lysates

      Secondary
      Conjugated secondary antibody at 1/10000 dilution
    • All lanes : Anti-IL-17A antibody (ab217359) at 1/1000 dilution

      Lane 1 : MOLT-4 cell lysate
      Lane 2 : U937 cell lysate

      Secondary
      All lanes : Conjugated secondary antibody at 1/10000 dilution
    • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human oral squamous cell carcinoma tissue labeling  IL-17A with ab217359 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

    References

    This product has been referenced in:

    • Jiang G  et al. IL-17A and GDF15 are able to induce epithelial-mesenchymal transition of lung epithelial cells in response to cigarette smoke. Exp Ther Med 16:12-20 (2018). Read more (PubMed: 29977354) »
    See 1 Publication for this product

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab217359.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up