Overview

  • Product name

  • Description

    Rabbit polyclonal to IL-17B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, Sandwich ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Hamster
  • Immunogen

    Recombinant full length protein corresponding to Human IL-17B aa 21-180. Highly pure (>98%); E coli derived mature protein
    Sequence:

    QPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMV AQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEAR CLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVME TIAVGCTCIF


    Database link: Q9UHF5

Properties

  • Form

    Lyophilised:Centrifuge vial prior to opening. Reconstitute in sterile water to a concentration of 0.1-1.0 mg/ml.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab190098 was purified by affinity chromatography employing immobilized hIL17B matrix.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab190098 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.1 - 0.2 µg/ml. Predicted molecular weight: 20 kDa.

Used in conjunction with compatible secondary reagents the detection limit for recombinant hIL17B is 1.5 - 3.0 ng/lane, under either reducing or non-reducing conditions.

Sandwich ELISA Use a concentration of 0.5 - 2 µg/ml.

ab190098 in conjunction with Biotinylated Anti-Human IL17B as a detection antibody, allows the detection of at least 0.2 - 0.4 ng/well of recombinant hIL17B.

Target

  • Function

    Stimulates the release of tumor necrosis factor alpha and IL-1-beta from the monocytic cell line THP-1.
  • Tissue specificity

    Expressed in adult pancreas, small intestine, stomach, spinal cord and testis. Less pronounced expression in prostate, colon mucosal lining, and ovary.
  • Sequence similarities

    Belongs to the IL-17 family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cytokine like protein Zcyto7 antibody
    • Cytokine Zcyto7 antibody
    • IL 17B antibody
    • IL 20 antibody
    • IL-17B antibody
    • IL-20 antibody
    • IL17B antibody
    • IL17B_HUMAN antibody
    • IL20 antibody
    • Interleukin 17 beta antibody
    • Interleukin 17B antibody
    • Interleukin 20 antibody
    • Interleukin-17B antibody
    • Interleukin-20 antibody
    • MGC138900 antibody
    • MGC138901 antibody
    • Neuronal interleukin 17 related factor antibody
    • Neuronal interleukin-17-related factor antibody
    • NIRF antibody
    • ZCYTO7 antibody
    see all

Images

  • Unreduced conditions.

  • Reduced conditions.

  • Sandwich ELISA using ab190098 at 0.5 µg/ml.

References

ab190098 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190098.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up