Overview

  • Product name
  • Description
    Mouse polyclonal to IL-17F
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rhesus monkey
  • Immunogen

    Full length protein corresponding to Human IL-17F aa 1-163.
    Sequence:

    MTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPV PGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQA QCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTV GCTCVTPVIHHVQ


    Database link: NP_443104.1

  • Positive control
    • IL17F transfected 293T cell lysate; Human small intestine tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab168194 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 18 kDa.
IHC-P Use a concentration of 3 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Ligand for IL17RA and IL17RC (PubMed:17911633). The heterodimer formed by IL17A and IL17F is a ligand for the heterodimeric complex formed by IL17RA and IL17RC (PubMed:18684971). Involved in stimulating the production of other cytokines such as IL6, IL8 and CSF2, and in regulation of cartilage matrix turnover (PubMed:11591732, PubMed:11591768, PubMed:11574464). Also involved in stimulating the proliferation of peripheral blood mononuclear cells and T-cells and in inhibition of angiogenesis (PubMed:11591732). Plays a role in the induction of neutrophilia in the lungs and in the exacerbation of antigen-induced pulmonary allergic inflammation.
  • Tissue specificity
    Expressed in activated, but not resting, CD4+ T-cells and activated monocytes.
  • Involvement in disease
    Candidiasis, familial, 6
  • Sequence similarities
    Belongs to the IL-17 family.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • CANDF6 antibody
    • Cytokine ML 1 antibody
    • Cytokine ML-1 antibody
    • IL 17F antibody
    • IL 24 antibody
    • IL-17F antibody
    • Il17f antibody
    • IL17F_HUMAN antibody
    • Interleukin 17F antibody
    • Interleukin 24 antibody
    • Interleukin-17F antibody
    • ML 1 antibody
    • ML1 antibody
    • Mutant IL 17F antibody
    • OTTHUMP00000016602 antibody
    see all

Images

  • All lanes : Anti-IL-17F antibody (ab168194) at 1 µg/ml

    Lane 1 : IL17F transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate


    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution

    Developed using the ECL technique.

    Predicted band size: 18 kDa

  • Immunohistochemical analysis of formalin fixed, paraffin embedded Human small intestine tissue labeling IL17F with ab168194 at 3 µg/ml.

References

This product has been referenced in:
  • Wu MS  et al. Interleukin-17F expression is elevated in hepatitis C patients with fibrosis and hepatocellular carcinoma. Infect Agent Cancer 12:42 (2017). Read more (PubMed: 28770001) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab168194.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up