Anti-IL-17F antibody (ab168194)
- Datasheet
- References (1)
- Protocols
Overview
-
Product nameAnti-IL-17F antibody
See all IL-17F primary antibodies -
DescriptionMouse polyclonal to IL-17F
-
Host speciesMouse
-
Tested applicationsSuitable for: WB, IHC-Pmore details
-
Species reactivityReacts with: Human
Predicted to work with: Rhesus monkey
-
Immunogen
Full length protein corresponding to Human IL-17F aa 1-163.
Sequence:MTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPV PGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQA QCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTV GCTCVTPVIHHVQ
Database link: NP_443104.1 -
Positive control
- IL17F transfected 293T cell lysate; Human small intestine tissue.
Properties
-
FormLiquid
-
Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
-
Storage bufferpH: 7.20
Constituent: 99% PBS -
Concentration information loading... -
PurityProtein A purified
-
ClonalityPolyclonal
-
IsotypeIgG
-
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab168194 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 1 µg/ml. Predicted molecular weight: 18 kDa. | |
| IHC-P | Use a concentration of 3 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
FunctionLigand for IL17RA and IL17RC (PubMed:17911633). The heterodimer formed by IL17A and IL17F is a ligand for the heterodimeric complex formed by IL17RA and IL17RC (PubMed:18684971). Involved in stimulating the production of other cytokines such as IL6, IL8 and CSF2, and in regulation of cartilage matrix turnover (PubMed:11591732, PubMed:11591768, PubMed:11574464). Also involved in stimulating the proliferation of peripheral blood mononuclear cells and T-cells and in inhibition of angiogenesis (PubMed:11591732). Plays a role in the induction of neutrophilia in the lungs and in the exacerbation of antigen-induced pulmonary allergic inflammation.
-
Tissue specificityExpressed in activated, but not resting, CD4+ T-cells and activated monocytes.
-
Involvement in diseaseCandidiasis, familial, 6
-
Sequence similaritiesBelongs to the IL-17 family.
-
Cellular localizationSecreted.
- Information by UniProt
-
Database links
- Entrez Gene: 112744 Human
- Omim: 606496 Human
- SwissProt: Q96PD4 Human
- Unigene: 272295 Human
-
Alternative names
- CANDF6 antibody
- Cytokine ML 1 antibody
- Cytokine ML-1 antibody
see all
Images
-
Western blot - Anti-IL-17F antibody (ab168194)All lanes : Anti-IL-17F antibody (ab168194) at 1 µg/ml
Lane 1 : IL17F transfected 293T cell lysate
Lane 2 : Non-transfected 293T cell lysate
Lysates/proteins at 15 µl per lane.
Secondary
All lanes : Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution
Developed using the ECL technique.
Predicted band size: 18 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IL-17F antibody (ab168194)Immunohistochemical analysis of formalin fixed, paraffin embedded Human small intestine tissue labeling IL17F with ab168194 at 3 µg/ml.
Datasheets and documents
References
This product has been referenced in:
- Wu MS et al. Interleukin-17F expression is elevated in hepatitis C patients with fibrosis and hepatocellular carcinoma. Infect Agent Cancer 12:42 (2017). Read more (PubMed: 28770001) »
