Overview

  • Product name

    Anti-IL-17RA Receptor antibody
    See all IL-17RA Receptor primary antibodies
  • Description

    Rabbit polyclonal to IL-17RA Receptor
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Human
  • Immunogen

    Synthetic peptide within Human IL-17RA Receptor aa 240-280 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    MENHSCFEHMHHIPAPRPEEFHQRSNVTLTLRNLKGCCRHQ


    Database link: Q96F46

  • Positive control

    • Mouse lymphoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab218249 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function

    Receptor for IL17A and IL17F. Binds its IL17A ligand with low affinity, suggesting that additional components are involved in IL17A-induced signaling.
  • Tissue specificity

    Widely expressed.
  • Involvement in disease

    Defects in IL17RA are the cause of familial candidiasis type 5 (CANDF5) [MIM:613953]. CANDF5 is a rare disorder with altered immune responses and impaired clearance of fungal infections, selective against Candida. It is characterized by persistent and/or recurrent infections of the skin, nails and mucous membranes caused by organisms of the genus Candida, mainly Candida albicans.
  • Sequence similarities

    Contains 1 SEFIR domain.
  • Post-translational
    modifications

    Glycosylated.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CANDF5 antibody
    • CD217 antibody
    • CD217 antigen antibody
    • CDw217 antibody
    • CTLA8 antibody
    • HIL 17R antibody
    • hIL17R antibody
    • I17RA_HUMAN antibody
    • IL 17 receptor A antibody
    • IL 17 receptor antibody
    • IL 17RA antibody
    • IL-17 receptor A antibody
    • IL-17RA antibody
    • IL17 antibody
    • IL17A receptor antibody
    • IL17R antibody
    • IL17RA antibody
    • IMD51 antibody
    • Interleukin 17 receptor A antibody
    • Interleukin-17 receptor A antibody
    • MGC10262 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse lymphoma tissue labeling IL-17RA with ab218249 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab218249 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab218249.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up