Anti-IL-17REL antibody (ab126399)
Key features and details
- Rabbit polyclonal to IL-17REL
- Suitable for: ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-IL-17REL antibody -
Description
Rabbit polyclonal to IL-17REL -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human IL-17REL aa 156-238.
Sequence:PVRVTANSVSQAVFLPYSQELPCLCLEGWSATPDAVRIQICPFENDTEAL EVLWDTVYYHPESQTLSWEPACPVSGHVSLCWR
-
Positive control
- Human duodenum tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab126399 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF |
Use a concentration of 1 - 4 µg/ml.
Recommend PFA Fixation and Triton X-100 treatment |
|
IHC-P |
1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
Notes |
---|
ICC/IF
Use a concentration of 1 - 4 µg/ml. Recommend PFA Fixation and Triton X-100 treatment |
IHC-P
1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
- Information by UniProt
-
Database links
- Entrez Gene: 400935 Human
- Omim: 613414 Human
- SwissProt: Q6ZVW7 Human
- Unigene: 526712 Human
-
Alternative names
- FLJ41993 antibody
- I17EL_HUMAN antibody
- IL-17 receptor E-like antibody
see all
Images
-
Immunofluorescent staining of Human cell line U-2 OS shows positivity in nucleoli and cytoplasm. Recommended concentration of ab126399 1-4 µg/ml. Cells treated with PFA/Triton X-100.
-
ab126399, at a dilution of 1/50, staining IL17REL in paraffin-embedded Human duodenum tissue by Immunohistochemistry.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab126399 has not yet been referenced specifically in any publications.