Overview

  • Product name

  • Description

    Rabbit polyclonal to IL-18
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human IL-18 aa 37-193. immunogen corresponding to mature protein (amino acids 37-193) of Human IL-18.
    Sequence:

    YFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFIIS MYKDSQPRGM AVTISVKCEKISTLSCENKIISFKEMNPPDNIKDTKSD IIFFQRSVPGHDNKMQFESSSY EGYFLACEKERDLFKLILKKEDELGD RSIMFTVQNED


    Database link: Q14116

  • Positive control

    • Human tonsil tissue, recombinant protein

Properties

Applications

Our Abpromise guarantee covers the use of ab191152 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC Use at an assay dependent concentration.
WB Use a concentration of 0.1 - 0.5 µg/ml. Predicted molecular weight: 22 kDa.

The detection limit for IL18 is approximately 1ng/lane under reducing conditions

IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells.
  • Sequence similarities

    Belongs to the IL-1 family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Iboctadekin antibody
    • IFN gamma inducing factor antibody
    • IFN-gamma-inducing factor antibody
    • IGIF antibody
    • IL 1 gamma antibody
    • IL 18 antibody
    • IL 1g antibody
    • IL-1 gamma antibody
    • IL-18 antibody
    • IL1 gamma antibody
    • IL18 antibody
    • IL18 protein antibody
    • IL18_HUMAN antibody
    • IL1F4 antibody
    • IL1g antibody
    • IL1gamma antibody
    • ILIF4 antibody
    • Interferon gamma inducing factor antibody
    • Interferon gamma-inducing factor antibody
    • Interleukin 1 gamma antibody
    • Interleukin 18 (interferon-gamma-inducing factor) antibody
    • Interleukin 18 antibody
    • Interleukin-1 gamma antibody
    • Interleukin-18 antibody
    • Interleukin18 antibody
    • MGC12320 antibody
    see all

Images

  • Anti-IL-18 antibody (ab191152) at 0.5 µg/ml + Recombinant Human IL-18 Protein at 0.0005 µg

    Predicted band size: 22 kDa

  • IL-18 was detected in immunocytochemical section of blood cell. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml ab191152 overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex with DAB as the chromogen

  • Immunohistochemical analysis of formalin fixed paraffine embedded human tonsil tissue labeling IL-18 with ab191152 at 1 µg/ml

References

This product has been referenced in:

  • Gugliandolo A  et al. Eruca sativa seed extract: A novel natural product able to counteract neuroinflammation. Mol Med Rep 17:6235-6244 (2018). Read more (PubMed: 29512782) »
  • Rawat P  et al. Human immunodeficiency virus Type-1 single-stranded RNA activates the NLRP3 inflammasome and impairs autophagic clearance of damaged mitochondria in human microglia. Glia N/A:N/A (2018). Read more (PubMed: 30582668) »
See all 5 Publications for this product

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Application
Western blot
Sample
Rhesus monkey Tissue lysate - whole (macaque retina)
Gel Running Conditions
Reduced Denaturing (4-15%)
Loading amount
273 µg
Specification
macaque retina
Blocking step
Milk as blocking agent for 1 hour(s) and 30 minute(s) · Concentration: 5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Oct 19 2018

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Rhesus monkey Tissue sections (macaque retina)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Tris EDTA pH 9
Permeabilization
No
Specification
macaque retina
Blocking step
Serum as blocking agent for 1 hour(s) and 30 minute(s) · Concentration: 5% · Temperature: 25°C
Fixative
NBF

Abcam user community

Verified customer

Submitted Oct 19 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up