Overview

  • Product name

  • Description

    Rabbit polyclonal to IL-18
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISAmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Rat IL-18 aa 37-194.
    Sequence:

    HFGRLHCTTAVIRSINDQVLFVDKRNPPVFEDMPDIDRTANESQTRLIIY MYKDSEVRGL AVTLSVKDGRMSTLSCKNKIISFEEMNPPENIDDIKSDLIFFQKRVPGHN KMEFESSLYEGHFLACQKEDDAFKLVLKRKDENGDKSVMFTLTNLHQS


    Database link: P97636

Properties

Applications

Our Abpromise guarantee covers the use of ab191860 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.1 - 0.5 µg/ml. Predicted molecular weight: 22 kDa.
ELISA Use a concentration of 0.1 - 0.5 µg/ml.

Target

  • Function

    Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells.
  • Sequence similarities

    Belongs to the IL-1 family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Iboctadekin antibody
    • IFN gamma inducing factor antibody
    • IFN-gamma-inducing factor antibody
    • IGIF antibody
    • IL 1 gamma antibody
    • IL 18 antibody
    • IL 1g antibody
    • IL-1 gamma antibody
    • IL-18 antibody
    • IL1 gamma antibody
    • IL18 antibody
    • IL18 protein antibody
    • IL18_HUMAN antibody
    • IL1F4 antibody
    • IL1g antibody
    • IL1gamma antibody
    • ILIF4 antibody
    • Interferon gamma inducing factor antibody
    • Interferon gamma-inducing factor antibody
    • Interleukin 1 gamma antibody
    • Interleukin 18 (interferon-gamma-inducing factor) antibody
    • Interleukin 18 antibody
    • Interleukin-1 gamma antibody
    • Interleukin-18 antibody
    • Interleukin18 antibody
    • MGC12320 antibody
    see all

Images

  • All lanes :

    Lane 1 : Rat brain tissue lysates
    Lane 2 : Rat lung tissue lysates
    Lane 3 : Rat spleen tissue lysates
    Lane 4 : Rat liver tissue lysates
    Lane 5 : Rat testis tissue lysates
    Lane 6 : Rat RH35 lysates
    Lane 7 : Rat PC-12 whole cell lysates

    Lysates/proteins at 50 µg per lane.

    Predicted band size: 22 kDa

References

This product has been referenced in:

  • Zhao J  et al. miRNA-20b inhibits cerebral ischemia-induced inflammation through targeting NLRP3. Int J Mol Med 43:1167-1178 (2019). Read more (PubMed: 30628668) »
  • Liu S  et al. Silica Particles Mediate Phenotypic and Functional Alteration of Dendritic Cells and Induce Th2 Cell Polarization. Front Immunol 10:787 (2019). Read more (PubMed: 31068929) »
See all 5 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191860.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up