Overview

  • Product name

    Anti-IL-18 antibody [C8]
    See all IL-18 primary antibodies
  • Description

    Mouse monoclonal [C8] to IL-18
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Cow
  • Immunogen

    Recombinant full length protein corresponding to Cow IL-18 aa 37-193. N-terminal His and T7 tags. Expressed in E. coli. Full length mature chain without the propeptide.
    Sequence:

    HFGKLEPKLSIIRNLNDQVLFINQGNQPVFEDMPDSDCSDNAPQTIFIIY MYKDSLTRGLAVTISVQCKKMSTLSCENKIVSFKEMNPPDNIDNEESDII FFQRSVPGHDDKIQFESSLYKGYFLACKKENDLFKLILKKQDDNRDKSVM FTVQNQN


    Database link: Q9TU73

  • Positive control

    • WB: Recombinant cow IL-18 protein. Cow thymus lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab239611 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml.

Target

  • Function

    Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells.
  • Sequence similarities

    Belongs to the IL-1 family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Iboctadekin antibody
    • IFN gamma inducing factor antibody
    • IFN-gamma-inducing factor antibody
    • IGIF antibody
    • IL 1 gamma antibody
    • IL 18 antibody
    • IL 1g antibody
    • IL-1 gamma antibody
    • IL-18 antibody
    • IL1 gamma antibody
    • IL18 antibody
    • IL18 protein antibody
    • IL18_HUMAN antibody
    • IL1F4 antibody
    • IL1g antibody
    • IL1gamma antibody
    • ILIF4 antibody
    • Interferon gamma inducing factor antibody
    • Interferon gamma-inducing factor antibody
    • Interleukin 1 gamma antibody
    • Interleukin 18 (interferon-gamma-inducing factor) antibody
    • Interleukin 18 antibody
    • Interleukin-1 gamma antibody
    • Interleukin-18 antibody
    • Interleukin18 antibody
    • MGC12320 antibody
    see all

Images

  • Anti-IL-18 antibody [C8] (ab239611) at 3 µg/ml + Cow thymus tissue lysate

    Secondary
    HRP-Goat Anti-Mouse IgG at 0.2 µg/ml
  • Anti-IL-18 antibody [C8] (ab239611) at 5 µg/ml + Recombinant cow IL-18 protein

References

ab239611 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239611.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up