Overview

  • Product name

  • Description

    Rabbit polyclonal to IL-18BP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human IL-18BP aa 113-194.
    Sequence:

    RLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRH VVLAQLWAGLRATLPPTQEALPSSHSSPQQQG


    Database link: O95998

  • Positive control

    • Human heart muscle tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab204487 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Isoform A binds to IL-18 and inhibits its activity. Functions as an inhibitor of the early TH1 cytokine response.
  • Tissue specificity

    Strongly expressed in heart, lung, placenta and spleen.
  • Sequence similarities

    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • I18BP_HUMAN antibody
    • IL-18BP antibody
    • IL18 binding protein antibody
    • IL18 BP antibody
    • IL18 BPa antibody
    • IL18BP antibody
    • IL18BPa antibody
    • Interleukin 18 binding protein antibody
    • Interleukin-18-binding protein antibody
    • MC51L 53L 54L homolog gene product antibody
    • Tadekinig alfa antibody
    • Tadekinig-alfa antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human heart muscle tissue labeling IL-18BP using ab204487 at a 1/500 dilution.

References

ab204487 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204487.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up